Recombinant Human RUNX2/CBFA1 Protein

Images

 
SDS-Page: Recombinant Human RUNX2/CBFA1 Protein [H00000860-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RUNX2/CBFA1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 251-350 of Human RUNX2/CBFA1

Source: Wheat Germ

Amino Acid Sequence: NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RUNX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RUNX2/CBFA1 Protein

  • Acute myeloid leukemia 3 protein
  • AML3CCD
  • CBFA1
  • CBFA1MGC120022
  • Core-binding factor subunit alpha-1
  • MGC120023
  • PEA2-alpha A
  • PEBP2A
  • PEBP2A1CCD1
  • PEBP2aA1
  • PEBP2-alpha A
  • runt domain, alpha subunit 1
  • runt-related transcription factor 2
  • RUNX2
  • SL3/AKV core-binding factor alpha A subunit
  • SL3-3 enhancer factor 1 alpha A subunit

Background

RUNX2 - runt-related transcription factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
355-BM/CF
Species: Hu, Mu, Rt
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB7547
Species: Hu
Applications: WB, ICC
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
355-BM/CF
Species: Hu, Mu, Rt
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
6449-TEC/CF
Species: Hu
NBP2-35212
Species: Hu
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
H00000860-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01) (0)

There are no publications for RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01) (0)

There are no reviews for RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01). (Showing 1 - 1 of 1 FAQ).

  1. We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
    • We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.

Additional Array Products

Bioinformatics Tool for RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01)

Discover related pathways, diseases and genes to RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01)

Discover more about diseases related to RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01).
 

Pathways for RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01)

View related products by pathway.

PTMs for RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01)

Learn more about PTMs related to RUNX2/CBFA1 Partial Recombinant Protein (H00000860-Q01).

Blogs on RUNX2/CBFA1

There are no specific blogs for RUNX2/CBFA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF
TRANCE/TNFSF11/RANK L
6449-TEC-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RUNX2/CBFA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX2
Entrez