RUNX2/CBFA1 Antibody (1D8)

Images

 
Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - RUNX2 monoclonal antibody (M01), clone 1D8. Analysis of RUNX2 expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Analysis of monoclonal antibody to RUNX2 on U-2 OS cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Analysis of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Western Blot analysis of RUNX2 expression in SJCRH30 ( Cat # L027V1 ).
Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Western Blot analysis of RUNX2 expression in K-562 ( Cat # L009V1 ).
Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Analysis of RUNX2 expression in transfected 293T cell line by RUNX2 monoclonal antibody (M01), clone 1D8.Lane 1: RUNX2 transfected lysate (Predicted MW: 60.28 ...read more
Sandwich ELISA: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Detection limit for recombinant GST tagged RUNX2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RUNX2/CBFA1 Antibody (1D8) Summary

Immunogen
RUNX2 (NP_004339, 251 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA
Specificity
RUNX2 - runt-related transcription factor 2
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
RUNX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00000860-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RUNX2/CBFA1 Antibody (1D8)

  • Acute myeloid leukemia 3 protein
  • AML3CCD
  • CBFA1
  • CBFA1MGC120022
  • Core-binding factor subunit alpha-1
  • MGC120023
  • PEA2-alpha A
  • PEBP2A
  • PEBP2A1CCD1
  • PEBP2aA1
  • PEBP2-alpha A
  • runt domain, alpha subunit 1
  • runt-related transcription factor 2
  • RUNX2
  • SL3/AKV core-binding factor alpha A subunit
  • SL3-3 enhancer factor 1 alpha A subunit

Background

This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
355-BM/CF
Species: Hu, Mu, Rt
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-38019
Species: Hu
Applications: IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
AF3075
Species: Hu
Applications: WB, ICC

Publications for RUNX2/CBFA1 Antibody (H00000860-M01)(3)

Reviews for RUNX2/CBFA1 Antibody (H00000860-M01) (0)

There are no reviews for RUNX2/CBFA1 Antibody (H00000860-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RUNX2/CBFA1 Antibody (H00000860-M01). (Showing 1 - 1 of 1 FAQs).

  1. We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
    • We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.

Secondary Antibodies

 

Isotype Controls

Additional RUNX2/CBFA1 Products

Bioinformatics Tool for RUNX2/CBFA1 Antibody (H00000860-M01)

Discover related pathways, diseases and genes to RUNX2/CBFA1 Antibody (H00000860-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RUNX2/CBFA1 Antibody (H00000860-M01)

Discover more about diseases related to RUNX2/CBFA1 Antibody (H00000860-M01).
 

Pathways for RUNX2/CBFA1 Antibody (H00000860-M01)

View related products by pathway.

PTMs for RUNX2/CBFA1 Antibody (H00000860-M01)

Learn more about PTMs related to RUNX2/CBFA1 Antibody (H00000860-M01).

Blogs on RUNX2/CBFA1

There are no specific blogs for RUNX2/CBFA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RUNX2/CBFA1 Antibody (1D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol RUNX2
Entrez
OMIM
Uniprot