Recombinant Human Rubicon GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Rubicon Protein [H00009711-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, PA, AP

Order Details

Recombinant Human Rubicon GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-375 of Human KIAA0226 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSSSNLFSSSSSQKPDSAASSLGDQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAPGNEEHRLLVSKMTLN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RUBCN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
67.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00009711-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Rubicon GST (N-Term) Protein

  • Baron
  • Beclin 1-interacting protein
  • Beclin-1 Associated RUN Domain Containing Protein
  • KIAA0226
  • RUBCN
  • Rubicon
  • RUN And Cysteine Rich Domain Containing Beclin 1 Interacting Protein
  • RUN Domain And Cysteine-Rich Domain Containing, Beclin 1-Interacting Protein
  • Run Domain Beclin-1-Interacting And Cysteine-Rich Domain-Containing Protein
  • rundataxin
  • SCAR15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP1-18885
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NBP2-24591
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-87320
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, KD
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NBP1-30463
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IP
NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-37975
Species: Hu
Applications: IHC, IHC-P
NB100-793
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA, IF
NBP2-50062
Species: Hu, Mu(-), Rt(-)
Applications: WB, ICC/IF, IHC

Publications for Rubicon Recombinant Protein (H00009711-P01)(1)

We have publications tested in 1 application: Func.


Filter By Application
Func
(1)
All Applications
Filter By Species
All Species

Reviews for Rubicon Recombinant Protein (H00009711-P01) (0)

There are no reviews for Rubicon Recombinant Protein (H00009711-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rubicon Recombinant Protein (H00009711-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Rubicon Products

Array H00009711-P01

Bioinformatics Tool for Rubicon Recombinant Protein (H00009711-P01)

Discover related pathways, diseases and genes to Rubicon Recombinant Protein (H00009711-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rubicon Recombinant Protein (H00009711-P01)

Discover more about diseases related to Rubicon Recombinant Protein (H00009711-P01).

Blogs on Rubicon.

Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.

Beclin 2, a mammal-specific homolog of Beclin 1 with unique functional similarities and differences
Beclin 2 (BECN2) is also called Beclin-1-like protein 1/ BECN1P1 and it was recently identified by He et al 2013 as a mammal-specific homolog of the evolutionarily conserved protein Beclin 1 which is well established for its role in the regulation...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Rubicon GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RUBCN