RTN3 Antibody

Images

 
Immunohistochemistry: RTN3 Antibody [NBP1-88870] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RTN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPQVKQQTDKSSDCITKTTGLDMSEYNSEIPVVNLKTSTHQKTPVCSIDGSTPITKSTGDWAEASLQQENAITGKPVPDSLNSTKEFSIKGVQGNMQKQDDTLAELPGSPPEKCDSLGSGVATVKVVLPDDHLKDEMDW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RTN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RTN3 Protein (NBP1-88870PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RTN3 Antibody

  • ASYIPASY interacting protein
  • HAP
  • isoforme III
  • isoforme VI
  • Neuroendocrine-specific protein-like 2
  • Neuroendocrine-specific protein-like II
  • NSPL2NSP-like protein II
  • NSPLIIhomolog of ASY protein
  • NSP-like protein 2
  • reticulon 3
  • reticulon-3
  • RTN3-A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP2-19533
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-19534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92450
Species: Hu
Applications: IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBL1-14964
Species: Hu
NBP1-88870
Species: Hu
Applications: IHC, IHC-P

Publications for RTN3 Antibody (NBP1-88870) (0)

There are no publications for RTN3 Antibody (NBP1-88870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTN3 Antibody (NBP1-88870) (0)

There are no reviews for RTN3 Antibody (NBP1-88870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RTN3 Antibody (NBP1-88870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RTN3 Products

Bioinformatics Tool for RTN3 Antibody (NBP1-88870)

Discover related pathways, diseases and genes to RTN3 Antibody (NBP1-88870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RTN3 Antibody (NBP1-88870)

Discover more about diseases related to RTN3 Antibody (NBP1-88870).
 

Pathways for RTN3 Antibody (NBP1-88870)

View related products by pathway.

PTMs for RTN3 Antibody (NBP1-88870)

Learn more about PTMs related to RTN3 Antibody (NBP1-88870).

Blogs on RTN3

There are no specific blogs for RTN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RTN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTN3