RTEL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RTEL1 Antibody [NBP2-57123] - Staining of human cell line CACO-2 shows localization to nuclear bodies.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RTEL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PKKHNLLQGFYQFVRPHHKQQFEEVCIQLTGRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQEHLNQG
Specificity
Specificity of human RTEL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RTEL1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RTEL1 Antibody

  • C20orf41
  • regulator of telomere elongation helicase 1
  • regulator of telomere length

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56506
Species: Hu, Mu, Rt, Ma
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP1-90450
Species: Hu
Applications: IHC, IHC-P
NB600-1522
Species: Hu, Mu
Applications: WB, GS, IB, ICC/IF, IHC
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NB100-186
Species: Hu
Applications: WB, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-214
Species: Hu, Mu
Applications: WB, IP
NB500-176
Species: Hu
Applications: WB
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-57123
Species: Hu
Applications: ICC/IF

Publications for RTEL1 Antibody (NBP2-57123) (0)

There are no publications for RTEL1 Antibody (NBP2-57123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTEL1 Antibody (NBP2-57123) (0)

There are no reviews for RTEL1 Antibody (NBP2-57123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RTEL1 Antibody (NBP2-57123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RTEL1 Products

Array NBP2-57123

Bioinformatics Tool for RTEL1 Antibody (NBP2-57123)

Discover related pathways, diseases and genes to RTEL1 Antibody (NBP2-57123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RTEL1 Antibody (NBP2-57123)

Discover more about diseases related to RTEL1 Antibody (NBP2-57123).
 

Pathways for RTEL1 Antibody (NBP2-57123)

View related products by pathway.

PTMs for RTEL1 Antibody (NBP2-57123)

Learn more about PTMs related to RTEL1 Antibody (NBP2-57123).
 

Research Areas for RTEL1 Antibody (NBP2-57123)

Find related products by research area.

Blogs on RTEL1

There are no specific blogs for RTEL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RTEL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTEL1