PHLDB1 Antibody

Images

 
Immunohistochemistry: PHLDB1 Antibody [NBP1-90451] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHLDB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AILDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTVLERRYHSLTGGRPFPKTTSTLKEMEKLLLPAVDLEQWYQELM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHLDB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PHLDB1 Protein (NBP1-90451PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHLDB1 Antibody

  • FLJ00141
  • LL5alpha
  • pleckstrin homology-like domain, family B, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22360
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-10820
Species: Hu
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3445
Species: Mu
Applications: WB, IHC
NBP2-14350
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38238
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14401
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81150
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-83398
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56628
Species: Hu
Applications: WB
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
26520002
Species: Hu
Applications: WB, ELISA
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90451
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PHLDB1 Antibody (NBP1-90451) (0)

There are no publications for PHLDB1 Antibody (NBP1-90451).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHLDB1 Antibody (NBP1-90451) (0)

There are no reviews for PHLDB1 Antibody (NBP1-90451). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PHLDB1 Antibody (NBP1-90451) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHLDB1 Products

Bioinformatics Tool for PHLDB1 Antibody (NBP1-90451)

Discover related pathways, diseases and genes to PHLDB1 Antibody (NBP1-90451). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHLDB1 Antibody (NBP1-90451)

Discover more about diseases related to PHLDB1 Antibody (NBP1-90451).
 

Pathways for PHLDB1 Antibody (NBP1-90451)

View related products by pathway.

PTMs for PHLDB1 Antibody (NBP1-90451)

Learn more about PTMs related to PHLDB1 Antibody (NBP1-90451).

Blogs on PHLDB1

There are no specific blogs for PHLDB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHLDB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHLDB1
Entrez
Uniprot