RTDR1 Antibody


Western Blot: RTDR1 Antibody [NBP1-86045] - Analysis in control (vector only transfected HEK293T lysate) and RTDR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: RTDR1 Antibody [NBP1-86045] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: RTDR1 Antibody [NBP1-86045] - Staining of human testis shows distinct positivity in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

RTDR1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKD
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RTDR1 Protein (NBP1-86045PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RTDR1 Antibody

  • MGC16968
  • rhabdoid tumor deletion region gene 1
  • rhabdoid tumor deletion region protein 1


RTDR1 encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Fe, Hu, RM
Applications: BA, BA
Species: Hu
Applications: ELISA, IP, WB
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Mu
Applications: PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: WB, IHC

Publications for RTDR1 Antibody (NBP1-86045) (0)

There are no publications for RTDR1 Antibody (NBP1-86045).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RTDR1 Antibody (NBP1-86045) (0)

There are no reviews for RTDR1 Antibody (NBP1-86045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RTDR1 Antibody (NBP1-86045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RTDR1 Products

Diseases for RTDR1 Antibody (NBP1-86045)

Discover more about diseases related to RTDR1 Antibody (NBP1-86045).

Pathways for RTDR1 Antibody (NBP1-86045)

View related products by pathway.

Research Areas for RTDR1 Antibody (NBP1-86045)

Find related products by research area.

Blogs on RTDR1

There are no specific blogs for RTDR1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RTDR1 Antibody and receive a gift card or discount.


Gene Symbol RSPH14