G Protein alpha z Antibody

Images

 
Western Blot: G Protein alpha z Antibody [NBP1-88111] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: G Protein alpha z Antibody [NBP1-88111] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: G Protein alpha z Antibody [NBP1-88111] - Staining of human cerebral cortex shows distinct positivity in neuropil.
Immunohistochemistry-Paraffin: G Protein alpha z Antibody [NBP1-88111] - Staining of human pancreas shows strong membranous and cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G Protein alpha z Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNAZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
G Protein alpha z Protein (NBP1-88111PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for G Protein alpha z Antibody

  • G(x) alpha chain
  • guanine nucleotide binding protein (G protein), alpha z polypeptide
  • guanine nucleotide-binding protein G(z) subunit alpha
  • gz-alpha
  • transducin alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008601-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33694
Species: Hu
Applications: WB, ICC/IF
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-20696
Species: Hu, Mu
Applications: WB, IHC-Fr
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P

Publications for G Protein alpha z Antibody (NBP1-88111) (0)

There are no publications for G Protein alpha z Antibody (NBP1-88111).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G Protein alpha z Antibody (NBP1-88111) (0)

There are no reviews for G Protein alpha z Antibody (NBP1-88111). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for G Protein alpha z Antibody (NBP1-88111) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G Protein alpha z Products

Bioinformatics Tool for G Protein alpha z Antibody (NBP1-88111)

Discover related pathways, diseases and genes to G Protein alpha z Antibody (NBP1-88111). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G Protein alpha z Antibody (NBP1-88111)

Discover more about diseases related to G Protein alpha z Antibody (NBP1-88111).
 

Pathways for G Protein alpha z Antibody (NBP1-88111)

View related products by pathway.

PTMs for G Protein alpha z Antibody (NBP1-88111)

Learn more about PTMs related to G Protein alpha z Antibody (NBP1-88111).

Blogs on G Protein alpha z

There are no specific blogs for G Protein alpha z, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G Protein alpha z Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAZ