RSRC2 Antibody

Images

 
Western Blot: RSRC2 Antibody [NBP1-83787] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: RSRC2 Antibody [NBP1-83787] - Staining of human cell line U-2 OS shows positivity in nucleoli and nucleus but not nucleoli.
Immunohistochemistry-Paraffin: RSRC2 Antibody [NBP1-83787] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RSRC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KKEGDKSQSAEIWEKLNFGNKDQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARSQTHTQRGMGLGFT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RSRC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RSRC2 Protein (NBP1-83787PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RSRC2 Antibody

  • arginine/serine-rich coiled-coil 2
  • arginine/serine-rich coiled-coil protein 2
  • FLJ11021

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB100-94995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-30691
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-87870
Species: Hu
Applications: IHC, IHC-P
H00009735-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-46085
Species: Hu
Applications: WB, IHC
NBL1-12154
Species: Hu

Publications for RSRC2 Antibody (NBP1-83787) (0)

There are no publications for RSRC2 Antibody (NBP1-83787).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSRC2 Antibody (NBP1-83787) (0)

There are no reviews for RSRC2 Antibody (NBP1-83787). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RSRC2 Antibody (NBP1-83787) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RSRC2 Products

Bioinformatics Tool for RSRC2 Antibody (NBP1-83787)

Discover related pathways, diseases and genes to RSRC2 Antibody (NBP1-83787). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RSRC2 Antibody (NBP1-83787)

Discover more about diseases related to RSRC2 Antibody (NBP1-83787).
 

Pathways for RSRC2 Antibody (NBP1-83787)

View related products by pathway.

Blogs on RSRC2

There are no specific blogs for RSRC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RSRC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RSRC2