RRP36 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RRP36 Antibody [NBP2-56838] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RRP36 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QPLQRMEQQEMAQQERKQQQELRLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKL
Specificity
Specificity of human RRP36 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RRP36
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RRP36 Recombinant Protein Antigen (NBP2-56838PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RRP36 Antibody

  • C6orf153
  • chromosome 6 open reading frame 153
  • dJ20C7.4
  • ribosomal RNA processing 36 homolog (S. cerevisiae)
  • ribosomal RNA processing protein 36 homolog
  • RNA processing factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Mu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IHC-Fr, IHC-P, IP, IHC-FrFl, KO
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
H00008189-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-67811
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr, KD
NBP2-92826
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-92686
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB, ICC/IF, IHC
NB100-40848
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, KD
NBP2-33958
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24859
Species: Hu, Mu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87246
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-56838
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for RRP36 Antibody (NBP2-56838) (0)

There are no publications for RRP36 Antibody (NBP2-56838).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRP36 Antibody (NBP2-56838) (0)

There are no reviews for RRP36 Antibody (NBP2-56838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RRP36 Antibody (NBP2-56838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RRP36 Products

Bioinformatics Tool for RRP36 Antibody (NBP2-56838)

Discover related pathways, diseases and genes to RRP36 Antibody (NBP2-56838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RRP36 Antibody (NBP2-56838)

View related products by pathway.

PTMs for RRP36 Antibody (NBP2-56838)

Learn more about PTMs related to RRP36 Antibody (NBP2-56838).

Blogs on RRP36

There are no specific blogs for RRP36, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRP36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RRP36