CLNS1A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CLNS1A Antibody [NBP2-33958] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CLNS1A Antibody [NBP2-33958] - Staining of human duodenum shows strong cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLNS1A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CLNS1A Antibody - BSA Free (NBP2-33958) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CLNS1A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLNS1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot Reported in scientific literature (PMID:34358446)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CLNS1A Protein (NBP2-33958PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLNS1A Antibody - BSA Free

• chloride channel regulatory protein
• Chloride channel, nucleotide sensitive 1A
• chloride channel, nucleotide-sensitive, 1A
• Chloride conductance regulatory protein ICln
• Chloride ion current inducer protein
• ClCI
• CLNS1B
• i(Cln)
• ICln
• methylosome subunit pICln
• Reticulocyte pICln
• reticulocyte protein ICln

Background

The CLNS1A gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerouscytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoproteinbiosynthesis, platelet activati

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CLNS1A Antibody (NBP2-33958)(1)

Publication using NBP2-33958

• Mulvaney KM, Blomquist C, Acharya N Et al. Molecular basis for substrate recruitment to the PRMT5 methylosome Molecular cell 2021-07-28 [PMID: 34358446] (WB, Human)

Review for CLNS1A Antibody (NBP2-33958) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Kathleen Mulvaney WB Human 03/20/2019

Summary

• Application: Western Blot
• Sample Tested: Human pancreatic cancer cell lines MiaPaCa-2, AsPC-1, and BxPC-3
• Species: Human
• Lot: R31249

Comments

• Comments: MiaPaca2 cells stably expressing Cas9 were infected with AAVS1 control or CLNS1A/pICLn targeting guide RNA lentivirus for 48h, selected for guide RNA infection with 1ug/ml puromycin for an additional 48h. Cells were lysed in RIPA, cleared by centrifugation, soluble protein was quantified by BCA, and 20ug of whole cell extract was added in each lane. CLNS1A/pICLn was detected with this antibody at 1:2,000 dilution overnight at 4C followed by secondary antibody 1:5,000 (LiCor) for 30 minutes at room temp and developed on a LiCor imager.

Bioinformatics

• Gene Symbol: CLNS1A
• Uniprot:
  • P54105(Human)