CLNS1A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CLNS1A Antibody [NBP2-33958] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CLNS1A Antibody [NBP2-33958] - Staining of human duodenum shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLNS1A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLNS1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CLNS1A Protein (NBP2-33958PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLNS1A Antibody

  • chloride channel regulatory protein
  • Chloride channel, nucleotide sensitive 1A
  • chloride channel, nucleotide-sensitive, 1A
  • Chloride conductance regulatory protein ICln
  • Chloride ion current inducer protein
  • ClCI
  • CLNS1B
  • I(Cln)
  • ICln
  • methylosome subunit pICln
  • Reticulocyte pICln
  • reticulocyte protein ICln

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56641
Species: Hu, Mu
Applications: WB
NBP1-91790
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46201
Species: Hu
Applications: WB, IHC
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-18237
Species: Hu

Publications for CLNS1A Antibody (NBP2-33958) (0)

There are no publications for CLNS1A Antibody (NBP2-33958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLNS1A Antibody (NBP2-33958) (0)

There are no reviews for CLNS1A Antibody (NBP2-33958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CLNS1A Antibody (NBP2-33958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLNS1A Products

Bioinformatics Tool for CLNS1A Antibody (NBP2-33958)

Discover related pathways, diseases and genes to CLNS1A Antibody (NBP2-33958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLNS1A Antibody (NBP2-33958)

Discover more about diseases related to CLNS1A Antibody (NBP2-33958).
 

Pathways for CLNS1A Antibody (NBP2-33958)

View related products by pathway.

PTMs for CLNS1A Antibody (NBP2-33958)

Learn more about PTMs related to CLNS1A Antibody (NBP2-33958).

Blogs on CLNS1A

There are no specific blogs for CLNS1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLNS1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLNS1A
Uniprot