Novus Biologicals products are now on bio-techne.com

RRP36 Antibody

Images

 
Western Blot: RRP36 Antibody [NBP1-86758] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: RRP36 Antibody [NBP1-86758] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Western Blot: RRP36 Antibody [NBP1-86758] - Analysis in control (vector only transfected HEK293T lysate) and RRP36 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RRP36 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQ
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RRP36
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RRP36 Protein (NBP1-86758PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RRP36 Antibody

  • C6orf153
  • chromosome 6 open reading frame 153
  • dJ20C7.4
  • ribosomal RNA processing 36 homolog (S. cerevisiae)
  • ribosomal RNA processing protein 36 homolog
  • RNA processing factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00008189-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ICC/IF, IHC, IHC-P, IP, WB
NBP1-88306
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
NB100-672
Species: Bv, Ca, Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, MiAr, WB
NBP3-04502
Species: Hu
Applications: ICC/IF, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-92686
Species: Ca, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-40848
Species: Hu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
NBP2-33958
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93867
Species: Hu, Mu, Rt
Applications: WB
NBP2-24859
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87246
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-86758
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for RRP36 Antibody (NBP1-86758) (0)

There are no publications for RRP36 Antibody (NBP1-86758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRP36 Antibody (NBP1-86758) (0)

There are no reviews for RRP36 Antibody (NBP1-86758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RRP36 Antibody (NBP1-86758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRP36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RRP36