Recombinant Human RPTOR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPTOR Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-379 of Human RPTOR full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW

Protein/Peptide Type
Recombinant Protein
Gene
RPTOR

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPTOR Protein

  • KIAA1303
  • KIAA1303p150 target of rapamycin (TOR)-scaffold protein containing WD-repeats
  • KOG1
  • Mip1
  • p150 target of rapamycin (TOR)-scaffold protein
  • Raptor
  • regulatory associated protein of MTOR, complex 1
  • regulatory-associated protein of mTOR
  • RPTOR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-611
Species: Hu
Applications: WB, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB3426
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-89865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4004
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
H00057521-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RPTOR Recombinant Protein (H00057521-P01) (0)

There are no publications for RPTOR Recombinant Protein (H00057521-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPTOR Recombinant Protein (H00057521-P01) (0)

There are no reviews for RPTOR Recombinant Protein (H00057521-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPTOR Recombinant Protein (H00057521-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPTOR Products

Bioinformatics Tool for RPTOR Recombinant Protein (H00057521-P01)

Discover related pathways, diseases and genes to RPTOR Recombinant Protein (H00057521-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPTOR Recombinant Protein (H00057521-P01)

Discover more about diseases related to RPTOR Recombinant Protein (H00057521-P01).
 

Pathways for RPTOR Recombinant Protein (H00057521-P01)

View related products by pathway.

PTMs for RPTOR Recombinant Protein (H00057521-P01)

Learn more about PTMs related to RPTOR Recombinant Protein (H00057521-P01).
 

Research Areas for RPTOR Recombinant Protein (H00057521-P01)

Find related products by research area.

Blogs on RPTOR

There are no specific blogs for RPTOR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

4EBP1 Antibody
NB200-157
RPTOR Antibody
NB100-331
Rictor Antibody
NB100-611

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPTOR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPTOR
Entrez