Novus Biologicals products are now on bio-techne.com

Recombinant Human RPTOR GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human RPTOR GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-379 of Human RPTOR full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RPTOR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
69.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00057521-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPTOR GST (N-Term) Protein

  • KIAA1303
  • KIAA1303p150 target of rapamycin (TOR)-scaffold protein containing WD-repeats
  • KOG1
  • Mip1
  • p150 target of rapamycin (TOR)-scaffold protein
  • Raptor
  • regulatory associated protein of MTOR, complex 1
  • regulatory-associated protein of mTOR
  • RPTOR

Background

Raptor (regulatory associated protein of TOR) is a conserved 150 kDa adaptor protein composed of a unique conserved region, three HEAT repeats and seven WD-40 repeats (1). Raptor recruits mTOR substrates S6K1 (p70 S6 kinase) and 4E-BP1, and regulates mTOR kinase activity (2-3). Even though Raptor is a positive regulator of mTOR, it has been shown that under nutrient deprivation, the Raptor-mTOR association is stabilized in a manner that inhibits mTOR kinase activity (1). Raptor association with mTOR is required for efficient S6K1 and 4E0BP1 phosphorylation (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-51645
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB200-157
Species: Hu
Applications: IHC, IHC-P, KO, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF8962
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24503
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00006009-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB40401
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-89865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4004
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00057521-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for RPTOR Recombinant Protein (H00057521-P01)(2)

Reviews for RPTOR Recombinant Protein (H00057521-P01) (0)

There are no reviews for RPTOR Recombinant Protein (H00057521-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPTOR Recombinant Protein (H00057521-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPTOR Products

Research Areas for RPTOR Recombinant Protein (H00057521-P01)

Find related products by research area.

Blogs on RPTOR

There are no specific blogs for RPTOR, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPTOR GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPTOR