RPTOR Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RPTOR Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPTOR.

  Source: E. coli

  Amino Acid Sequence: VSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: RPTOR
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56133.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPTOR Recombinant Protein Antigen

• KIAA1303
• KIAA1303p150 target of rapamycin (TOR)-scaffold protein containing WD-repeats
• KOG1
• Mip1
• p150 target of rapamycin (TOR)-scaffold protein
• Raptor
• regulatory associated protein of MTOR, complex 1
• regulatory-associated protein of mTOR
• RPTOR

Background

Raptor (regulatory associated protein of TOR) is a conserved 150 kDa adaptor protein composed of a unique conserved region, three HEAT repeats and seven WD-40 repeats (1). Raptor recruits mTOR substrates S6K1 (p70 S6 kinase) and 4E-BP1, and regulates mTOR kinase activity (2-3). Even though Raptor is a positive regulator of mTOR, it has been shown that under nutrient deprivation, the Raptor-mTOR association is stabilized in a manner that inhibits mTOR kinase activity (1). Raptor association with mTOR is required for efficient S6K1 and 4E0BP1 phosphorylation (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: RPTOR