RPL5 Antibody

Images

 
Western Blot: RPL5 Antibody [NBP1-74074] - Titration: 1.0 ug/ml Positive Control: Mouse Heart.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL5 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Rpl5. Immunizing peptide sequence RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Rpl5 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPL5 Antibody

  • DBA6,60S ribosomal protein L5
  • MGC117339
  • ribosomal protein L5

Background

Rpl5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-74074
Species: Mu
Applications: WB

Publications for RPL5 Antibody (NBP1-74074) (0)

There are no publications for RPL5 Antibody (NBP1-74074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL5 Antibody (NBP1-74074) (0)

There are no reviews for RPL5 Antibody (NBP1-74074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL5 Antibody (NBP1-74074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL5 Products

Bioinformatics Tool for RPL5 Antibody (NBP1-74074)

Discover related pathways, diseases and genes to RPL5 Antibody (NBP1-74074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL5 Antibody (NBP1-74074)

Discover more about diseases related to RPL5 Antibody (NBP1-74074).
 

Pathways for RPL5 Antibody (NBP1-74074)

View related products by pathway.

PTMs for RPL5 Antibody (NBP1-74074)

Learn more about PTMs related to RPL5 Antibody (NBP1-74074).

Blogs on RPL5

There are no specific blogs for RPL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL5
Uniprot