RPL5 Antibody

Images

 
Western Blot: RPL5 Antibody [NBP1-57126] - Sample Type: Arabidopsis thaliana extract (30ug) Primary Diltution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:15,000 Exposure Time: 1 minute Image ...read more
Western Blot: RPL5 Antibody [NBP1-57126] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Product Details

Summary
Reactivity Hu, AtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL5 Antibody Summary

Immunogen
Synthetic peptides corresponding to RPL5(ribosomal protein L5) The peptide sequence was selected from the N terminal of RPL5 (NP_000960). Peptide sequence RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RPL5 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-57126.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPL5 Antibody

  • DBA6,60S ribosomal protein L5
  • MGC117339
  • ribosomal protein L5

Background

RPL5 is required for rRNA maturation and formation of the 60S ribosomal subunits. This protein binds 5S RNA.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18P family of ribosomal proteins. It is located in the cytoplasm. The protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The protein interacts specifically with the beta subunit of casein kinase II. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-57126
Species: Hu, At
Applications: WB

Publications for RPL5 Antibody (NBP1-57126)(1)


Reviews for RPL5 Antibody (NBP1-57126) (0)

There are no reviews for RPL5 Antibody (NBP1-57126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL5 Antibody (NBP1-57126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPL5 Products

Bioinformatics Tool for RPL5 Antibody (NBP1-57126)

Discover related pathways, diseases and genes to RPL5 Antibody (NBP1-57126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL5 Antibody (NBP1-57126)

Discover more about diseases related to RPL5 Antibody (NBP1-57126).
 

Pathways for RPL5 Antibody (NBP1-57126)

View related products by pathway.

PTMs for RPL5 Antibody (NBP1-57126)

Learn more about PTMs related to RPL5 Antibody (NBP1-57126).

Blogs on RPL5

There are no specific blogs for RPL5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL5
Entrez
Uniprot
Novus 100% Guarantee