RPH3AL Antibody

Images

 
Immunohistochemistry-Paraffin: RPH3AL Antibody [NBP1-80991] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPH3AL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMGNG
Specificity
Specificity of human RPH3AL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPH3AL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPH3AL Protein (NBP1-80991PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPH3AL Antibody

  • Noc2
  • NOC2No C2 domains protein
  • rab effector Noc2
  • rabphilin 3A-like (without C2 domains)
  • Rabphilin-3A-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
H00022999-R01
Species: Hu
NBP1-87940
Species: Hu
Applications: IHC, IHC-P
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76905
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33037
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57641
Species: Hu
Applications: WB, ICC/IF
H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-80991
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RPH3AL Antibody (NBP1-80991) (0)

There are no publications for RPH3AL Antibody (NBP1-80991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPH3AL Antibody (NBP1-80991) (0)

There are no reviews for RPH3AL Antibody (NBP1-80991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RPH3AL Antibody (NBP1-80991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RPH3AL Antibody (NBP1-80991)

Discover related pathways, diseases and genes to RPH3AL Antibody (NBP1-80991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPH3AL Antibody (NBP1-80991)

Discover more about diseases related to RPH3AL Antibody (NBP1-80991).
 

Pathways for RPH3AL Antibody (NBP1-80991)

View related products by pathway.

PTMs for RPH3AL Antibody (NBP1-80991)

Learn more about PTMs related to RPH3AL Antibody (NBP1-80991).

Blogs on RPH3AL

There are no specific blogs for RPH3AL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPH3AL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPH3AL