RPB8 Antibody

Images

 
Western Blot: RPB8 Antibody [NBP1-53016] - HepG2 cell lysate, concentration 5.0ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPB8 Antibody Summary

Immunogen
Synthetic peptides corresponding to POLR2H(polymerase (RNA) II (DNA directed) polypeptide H) The peptide sequence was selected from the N terminal of human POLR2H. Peptide sequence DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE.
Specificity
This product is specific to Subunit or Isofrom: RPABC3.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR2H
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against POLR2H and was validated on Western blot.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPB8 Antibody

  • DNA-directed RNA polymerases I, II, and III subunit RPABC3
  • hsRPB8
  • II, and III 17.1 kDa polypeptide
  • II, and III subunit ABC3
  • polymerase (RNA) II (DNA directed) polypeptide H
  • RPB8 homolog

Background

POLR2H is one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III.This gene encodes one of the essential subunits of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins. They are also a target of the transforming proteins of small DNA tumor viruses. Many E2F proteins contain several evolutionarily conserved domains: a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The encoded protein of this gene is atypical because it lacks the transactivation and tumor suppressor protein association domains. It contains a modular suppression domain and is an inhibitor of E2F-dependent transcription. The protein is part of a multimeric protein complex that contains a histone methyltransferase and the transcription factors Mga and Max. Multiple transcript variants have been reported for this gene, but it has not been clearly demonstrated that they encode valid isoforms. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-400 AU142999.1 1-400 401-907 BI772069.1 287-793 908-1792 BC008348.1 928-1812 1793-3185 AC099344.4 111461-112853 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81714
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55856
Species: Hu
Applications: ICC/IF
NBP1-92344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009533-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76929
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1726
Species: Hu
Applications: WB, IHC, ICC
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83204
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RPB8 Antibody (NBP1-53016) (0)

There are no publications for RPB8 Antibody (NBP1-53016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPB8 Antibody (NBP1-53016) (0)

There are no reviews for RPB8 Antibody (NBP1-53016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPB8 Antibody (NBP1-53016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPB8 Products

Bioinformatics Tool for RPB8 Antibody (NBP1-53016)

Discover related pathways, diseases and genes to RPB8 Antibody (NBP1-53016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RPB8 Antibody (NBP1-53016)

View related products by pathway.

PTMs for RPB8 Antibody (NBP1-53016)

Learn more about PTMs related to RPB8 Antibody (NBP1-53016).

Blogs on RPB8

There are no specific blogs for RPB8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPB8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2H
Entrez
Uniprot