Home » RPA70 » RPA70 Proteins » RPA70 Recombinant Protein Antigen

RPA70 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RPA70 Protein (NBP1-89658PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

RPA70 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPA1.

Source: E.coli

Amino Acid Sequence: SLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89658.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for RPA70 Recombinant Protein Antigen

  • HSSB
  • MST075
  • MSTP075
  • REPA1RF-A protein 1
  • Replication factor A protein 1
  • replication protein A 70 kDa DNA-binding subunit
  • replication protein A1 (70kD)
  • replication protein A1, 70kDa
  • RF-A
  • RP-A
  • RPA70RP-A p70
  • Single-stranded DNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(4 Reviews)
(25 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
RPA2 [p Ser4, p
Ser8] Antibody
NBP1-23017
Western Blot: RPA2 [p Ser4, p Ser8] Antibody [NBP1-23017] - Detection of Human Phospho RPA32 (S4/S8) by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa cells treated with 100 uM etoposide for 4 hours (+) or mock treated (-) cells. Antibodies: Affinity purified rabbit anti-Phospho RPA32 (S4/S8) antibody NBP1-23017 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds. Lower panel shows Westen Blot for total RPA32 using affinity purified rabbit anti-RPA32 antibody A300-244A at 0.1 ug/ml with an exposure time of 30 seconds.
Immunohistochemistry: RPA2 [p Ser4, p Ser8] Antibody [NBP1-23017] - Sample: FFPE section of mouse teratoma. Antibody: Affinity purified rabbit anti- Phospho (S4/S8) used at a dilution of 1:1,000 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Western Blot: RPA2 [p Ser4, p Ser8] Antibody [NBP1-23017] - Samples: Whole cell lysate (50 ug for WB in A; 1 mg for IP, 20% of IP loaded in B) from HeLa Cells that had been treated with etoposide (+) or mock treated (-). In B, immunoprecipitated RPA32 was either treated with phosphatase (+) or mock treated (-). Antibodies: Phosphorylated RPA32 was detected using rabbit anti-phospho RPA32 Ser4/Ser8 antibody NBP1-23017 lot 2 at 1 ug/ml. Total RPA32 was detected using rabbit anti-RPA32 antibody NB100-332 at 1 ug/ml. RPA32 was immunoprecipitated using NB100-332 at 3 ug/mg lysate. Detection: Chemiluminescence with exposure times of 30 seconds for phospho RPA32 Ser4/Ser8 (A and B) and 1 second for total RPA32 (A and B).
(27 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
XPA Antibody
NB100-93321
Western Blot: XPA Antibody [NB100-93321] - Detection of Human XPA by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa, cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-XPA antibody NB100-93321 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry: XPA Antibody [NB100-93321] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- XPA used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Western Blot: XPA Antibody [NB100-93321] - Whole cell lysate (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded) from HeLa cells. NB100-93321 used for WB at 0.04 mcg/ml (A) and 0.1 mcg/ml (B) and used for IP at 3 mcg/mg lysate
Species: Hu
Applications: WB, IHC, IHC-P, IP
Rad51 Antibody
(14B4)
NB100-148
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Immunocytochemistry/Immunofluorescence: Rad51 Antibody (14B4) [NB100-148] - staning of RAD51 nuclear foci in U2OS cells using RAD51 14B4 antibody. Cells were pre-extracted with CSK buffer before fixation with 4% PFA. RAD51 14B4 was used at 1:1000 dultion. DAPI was used to counterstain the nucleus. Scale bar, 10 mciro-meter.
Immunohistochemistry-Paraffin: Rad51 Antibody (14B4) [NB100-148] - Detects RAD51 in nucleus on BT483 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded BT483 xenograft. RAD51 antibody 14B4 at a dilution of 1:200.
(3 Reviews)
(39 Publications)
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
RPA14 Antibody
(11.1)
NB100-159
Western Blot: RPA14 Antibody (11.1) [NB100-159] - A. 30 ug A549 whole cell lysate/extract B. 30 ug MCF-7 whole cell lysate/extract 15 % SDS-PAGE RPA14 antibody [11.1] dilution: 1:1000
Immunohistochemistry-Paraffin: RPA14 Antibody (11.1) [NB100-159] - Paraffin-embedded Mahlarvu xenograft. RPA14 antibody [11.1] dilution: 1:200.
Western Blot: RPA14 Antibody (11.1) [NB100-159] - Sample (30 ug of whole cell lysate) A: MCF7 15% SDS PAGE, antibody diluted at 1:500.
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
ATR Antibody (2B5)
NB100-308
Western Blot: ATR Antibody (2B5) [NB100-308] - Human Raji whole cell extract. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ATR Antibody (2B5) [NB100-308] - Analysis of HeLa, using antibody at 1:100 dilution.
Western Blot: ATR Antibody (2B5) [NB100-308] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody [2B5] diluted at 1:500.
(17 Publications)
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
POLR1B Antibody
(4H6)
H00084172-M10
Western Blot: POLR1B Antibody (4H6) [H00084172-M10] - Analysis of POLR1B expression in transfected 293T cell line by POLR1B monoclonal antibody (M10), clone 4H6. Lane 1: POLR1B transfected lysate (Predicted MW: 128.2 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: POLR1B Antibody (4H6) [H00084172-M10] - Analysis of monoclonal antibody to POLR1B on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: POLR1B Antibody (4H6) [H00084172-M10] - Detection limit for recombinant GST tagged POLR1B is 3 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
GTF2H3 Antibody
NBP2-30371
Immunocytochemistry/Immunofluorescence: GTF2H3 Antibody [NBP2-30371] - Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm.
Immunohistochemistry: GTF2H3 Antibody [NBP2-30371] - Staining of human kidney shows strong cytoplasmic, membranous and nuclear positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DNA-PKcs Antibody
(3H6)
NBP2-22128
Western Blot: DNA PKcs Antibody (3H6) [NBP2-22128] - Western blot image of DNA PKcs. HeLa (lane A), MCF7 (lane B) and HEK293 (lane C) whole cell protein was separated by SDS-PAGE on 6% gel, transferred to PVDF and probed with NBP2-22128. A single band of DNA PKcs reactivity at approximately 460 kDa was detected in all lysates.
Immunocytochemistry/Immunofluorescence: DNA PKcs Antibody (3H6) [NBP2-22128] - Immunofluorescence analysis of Hela cells using DNA PKcs mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: DNA PKcs Antibody (3H6) [NBP2-22128] - Immunohistochemical analysis of paraffin-embedded lung cancer (left) and brain tissues (right) using DNA PKcs mouse mAb with DAB staining.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
MMAB Antibody
(OTI2G5)
NBP2-03417
Western Blot: MMAB Antibody (2G5) [NBP2-03417] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MMAB (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MMAB.
Immunohistochemistry-Paraffin: MMAB Antibody (2G5) [NBP2-03417] Staining of paraffin-embedded Human lymph node tissue using anti-MMAB mouse monoclonal antibody.
Flow Cytometry: MMAB Antibody (2G5) [NBP2-03417] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-MMAB antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
TEM8/ANTXR1
Antibody (200C1339(SB
NB100-56585
Western Blot: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Detection in TEM8 transfected cell lysate using this antibody.
Immunohistochemistry-Paraffin: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Detection of TEM8/ANTXR1 in human liver cancer section using 5 ug/ml concentration of TEM8 antibody. Uniform weak staining was observed in the cancerous cells, while the blood vessels depicted the expected intense positivity for TEM8.
Western Blot: TEM8/ANTXR1 Antibody (200C1339(SB20)) [NB100-56585] - Analysis of human heart lysates (35ug per lane, RIPA buffer) using TEM8 antibody (NB100-56585) at 0.3ug/ml. Band observed at 65kDa. (Expected MW of 62.8kDa according to NP_115584.1).
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
SSB Antibody
NBP1-33549
Western Blot: SSB Antibody [NBP1-33549] - Sample (30 ug of whole cell lysate) A: 293T 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SSB Antibody [NBP1-33549] - Analysis of paraformaldehyde-fixed A431, using SSB (NBP1-33549) antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: SSB Antibody [NBP1-33549] - Paraffin-embedded mouse fore brain. SSB antibody dilution: 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Annexin A6 Antibody
NBP1-90149
Western Blot: Annexin A6 Antibody [NBP1-90149] - Analysis in human cell lines SK-MEL-30 and A-431 using anti-ANXA6 antibody. Corresponding ANXA6 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunohistochemistry-Paraffin: Annexin A6 Antibody [NBP1-90149] - Staining of human appendix shows high expression.
Western Blot: Annexin A6 Antibody [NBP1-90149] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
ATM Antibody
NB100-104
Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using NB100-104.
Immunocytochemistry/Immunofluorescence: ATM Antibody [NB100-104] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.05% Triton X-100. Then cells were incubated with anti-ATM (NB100-104) at a 1:100 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone.
(2 Reviews)
(84 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Chk1 Antibody
(2G1D5)
NB100-1768
Western Blot: Chk1 Antibody (2G1D5) [NB100-1768] - Analysis using Chk1 mouse mAb against HEK293T cells transfected with the pCMV6-ENTRY control (1) and pCMV6-ENTRY Chk1 cDNA (2).
Immunocytochemistry/Immunofluorescence: Chk1 Antibody (2G1D5) [NB100-1768] - Chk1 antibody was tested at 1:10 in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40X.
Immunohistochemistry-Paraffin: Chk1 Antibody (2G1D5) [NB100-1768] - Analysis of FFPE human lung using Chk1 antibody (clone 2G1D5) at 1:250 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10 mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Cytoplasmic and nuclear staining of Chk1 was observed as this is a ubiquitous cell checkpoint protein. Staining was performed by Histowiz.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

UBASH3B/STS1/Tula-2 An
AF6696
Western blot shows lysates of HCT‑116 human colorectal carcinoma cell line, HEK293 human embryonic kidney cell line, MOLT‑4 human acute lymphoblastic leukemia cell line, U‑118‑MG human glioblastoma/astrocytoma cell line, U2OS human osteosarcoma cell line, and Y3‑Ag rat myeloid cell line. PVDF Membrane was probed with 2 µg/mL of Human/Rat UBASH3B/STS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6696) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for UBASH3B/STS1 at approximately 72 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
UBASH3B/STS1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Sheep Anti-Human/Mouse/Rat UBASH3B/STS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6696) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red, upper panel; Catalog # NL010) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu, Rt
Applications: WB, ICC
PP2A alpha Antibody
NBP1-31266
Western Blot: PP2A alpha Antibody [NBP1-31266] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PP2A alpha antibody. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PPP2R4 Antibody [NBP1-31266] - Paraformaldehyde-fixed HeLa, using PP2A alpha antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: PPP2R4 Antibody [NBP1-31266] - Paraffin-embedded A549 xenograft, using antibody at 1:100 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
LXR beta/NR1H2
Antibody
NB100-74457
Western Blot: LXR beta/NR1H2 Antibody [NB100-74457] - 25 ug of rat liver (Lane 1), mouse liver (Lane 2) and Hela (Lane 3) cell lysates.
Immunocytochemistry/Immunofluorescence: LXR beta/NR1H2 Antibody [NB100-74457] - Analysis of LXR beta (green) showing positive staining in the nuclear envelope of C2C12 cells (right) compared with a negative control in the absence of primary antibody (left).
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
RPA70 Recombinant
Protein Antigen
NBP1-89658PEP
RPA70 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for RPA70 Protein (NBP1-89658PEP) (0)

There are no publications for RPA70 Protein (NBP1-89658PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPA70 Protein (NBP1-89658PEP) (0)

There are no reviews for RPA70 Protein (NBP1-89658PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for RPA70 Protein (NBP1-89658PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for RPA70 Protein (NBP1-89658PEP)

Discover related pathways, diseases and genes to RPA70 Protein (NBP1-89658PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPA70 Protein (NBP1-89658PEP)

Discover more about diseases related to RPA70 Protein (NBP1-89658PEP).
 

Pathways for RPA70 Protein (NBP1-89658PEP)

View related products by pathway.

PTMs for RPA70 Protein (NBP1-89658PEP)

Learn more about PTMs related to RPA70 Protein (NBP1-89658PEP).
 

Research Areas for RPA70 Protein (NBP1-89658PEP)

Find related products by research area.

Blogs on RPA70

There are no specific blogs for RPA70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Recombinant Human RPA70 Protein [H00006117-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human RPA70 Protein
H00006117-Q01-10ug
Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using NB100-104.
ATM Antibody
NB100-104
Western Blot: RPA70 Antibody [NB100-2204] - Whole cell lysate (50 ug) from NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiRPA70 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
RPA70 Antibody
NB100-2204
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Rad51 Antibody (14B4)
NB100-148

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RPA70 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RPA1