RPA14 Antibody - BSA Free

Western Blot: RPA14 Antibody [NBP3-38316] - Western blot analysis of various lysates using RPA14 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

Immunocytochemistry/ Immunofluorescence: RPA14 Antibody [NBP3-38316] - Immunofluorescence analysis of MCF7 cells using RPA14 Rabbit pAb.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPA14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RPA14 Antibody - BSA Free (NBP3-38316) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 6-121 of human RPA14 (NP_002938.1).
  
  Sequence:
  DLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 14 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RPA14 Antibody - BSA Free

• REPA3Replication factor A protein 3
• replication protein A 14 kDa subunit
• replication protein A3 (14kD)
• replication protein A3, 14kDa
• RF-A protein 3
• RP-A p14
• RPA14

Background

Replication protein A (RPA) is a single-stranded DNA binding protein. Human RPA is a heterotrimeric protein containing subunits of 70, 32 and 14 kDa. This protein complex is highly conserved in eukaryotes and is essential in DNA replication, homologous recombination and nucleotide excision repair. RPA has been shown to be a target for DNA-dependent protein kinase (DNA-PK) ataxia telangiectasia-mutated gene (ATM) and a cyclin dependent protein kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPA3