| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DVICLNSDDIMPVALMETKNREGLNYMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNYACLTHSGYGDGSD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ROS1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ROS Antibody (NBP2-56053)Find related products by research area.
|
|
Tired T cells: Hypoxia Drives T cell Exhaustion in the Tumor Microenvironment By Hunter MartinezThe paradigm shifting view of the immune system being leveraged to target cancer has led to numerous therapeutic breakthroughs. One major cell group responsible for this revelation is a T cell. ... Read full blog post. |
|
Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm... Read full blog post. |
|
NOX2 oxidase is a potential target for broad-spectrum antiviral therapies By Beth Melson, MSViral infection induces the production of reactive oxygen species (ROS) by inflammatory cells, the majority of which is produced by the NOX2 oxidase. While NOX2 oxidase contributes to the clearan... Read full blog post. |
|
Crosstalk Between Oxidative Stress and Autophagy By Christina Towers, PhD. Role of Reactive Species in Cellular FunctionOxidative stress is a byproduct of an imbalance between oxidants and antioxidants present in the cell, resulting in dysfunctional redox si... Read full blog post. |
|
One MAP to Navigate the Oxidative Stress, Tumorigenesis and Apoptosis Pathways? Reactive oxygen species, ROS, are beneficially involved in many signaling pathways that control development and maintain cellular homeostasis. In physiological conditions, a tightly regulated redox balance protects cells from injurious ROS activity, a... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ROS1 |