We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human ROR gamma/RORC/NR1F3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ROR gamma/RORC/NR1F3 Protein [H00006097-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related ROR gamma/RORC/NR1F3 Peptides and Proteins

Order Details


    • Catalog Number
      H00006097-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ROR gamma/RORC/NR1F3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-518 of Human RORC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
RORC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
84.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ROR gamma/RORC/NR1F3 GST (N-Term) Protein

  • MGC129539
  • NR1F3
  • Nuclear receptor ROR gamma
  • Nuclear receptor ROR-gamma
  • Nuclear receptor RZR gamma
  • Nuclear receptor RZR-gamma
  • Nuclear receptor subfamily 1 group F member 3
  • RAR-Related Orphan Nuclear Receptor Variant 2
  • RAR-related orphan receptor C
  • RAR-related orphan receptor gamma
  • retinoic acid-binding receptor gamma
  • retinoid-related orphan receptor gamma
  • Retinoid-related orphan receptor-gamma
  • ROR gamma
  • RORC
  • RORG
  • RORGMGC129539
  • RZRG
  • RZRGRZR-GAMMA
  • TOR

Background

The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-111
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-Fr, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
DY421
Species: Mu
Applications: ELISA
NBP1-89865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
782-IL
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-22356
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-16729
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, Simple Western, WB
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NBP2-46234
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-82489
Species: Hu
Applications: ELISA
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB

Publications for ROR gamma/RORC/NR1F3 Recombinant Protein (H00006097-P01) (0)

There are no publications for ROR gamma/RORC/NR1F3 Recombinant Protein (H00006097-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ROR gamma/RORC/NR1F3 Recombinant Protein (H00006097-P01) (0)

There are no reviews for ROR gamma/RORC/NR1F3 Recombinant Protein (H00006097-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ROR gamma/RORC/NR1F3 Recombinant Protein (H00006097-P01). (Showing 1 - 2 of 2 FAQ).

  1. Does ROR gamma/RORC/NR1F3 antibodies comes in lyophilized form?
    • Yes, we have 3 RORC antibodies delivere in lyophilized form: MAB61091, MAB61092, MAB6109.
  2. What the theoretical molecular weight for ROR gamma/RORC/NR1F3 antibodies?
    • The TMW of ROR gamma/RORC/NR1F3 antibodies is approximately 56 - 60.

Additional ROR gamma/RORC/NR1F3 Products

Research Areas for ROR gamma/RORC/NR1F3 Recombinant Protein (H00006097-P01)

Find related products by research area.

Blogs on ROR gamma/RORC/NR1F3

There are no specific blogs for ROR gamma/RORC/NR1F3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ROR gamma/RORC/NR1F3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RORC