ROR beta Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ROR beta. Peptide sequence: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RORB |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for ROR beta Antibody - BSA Free
Background
Retinoid-related orphan receptor beta (ROR beta), a NR1 thyroid hormone receptor, affects the development and functioning of the central nervous system, including sensory input integration and circadian timing. Disruption of ROR beta in mice results in juvenile ataxia, retinal degeneration, circadian activity abnormalities, and delayed onset of male fertility. ROR beta binds to the monomeric response elements containing the sequence AnnTAGGTCA as a monomer. An alternatively spliced isoform, ROR beta2, has been isolated from rats, and the expression of ROR beta2 is confined to the pineal gland and retina. ROR beta2 shares common DNA- and putative ligand-binding domains with wild-type ROR beta but is characterized by a different amino-terminal domain. ROR beta expression has been documented in various regions of the mouse brain. ESTs have been isolated from human tissue libraries, including cancerous human kidney and normal brain, pineal and eye.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: WB
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for ROR beta Antibody (NBP2-88172) (0)
There are no publications for ROR beta Antibody (NBP2-88172).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ROR beta Antibody (NBP2-88172) (0)
There are no reviews for ROR beta Antibody (NBP2-88172).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ROR beta Antibody (NBP2-88172) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ROR beta Products
Research Areas for ROR beta Antibody (NBP2-88172)
Find related products by research area.
|
Blogs on ROR beta