Kv10.2 Antibody

Images

 
Western Blot: Kv10.2 Antibody [NBP2-83132] - WB Suggested Anti-KCNH5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate
Immunohistochemistry: Kv10.2 Antibody [NBP2-83132] - Human Brain

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv10.2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human Kv10.2. Peptide sequence: LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNH5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv10.2 Antibody

  • hEAG2
  • potassium channel HEAG2
  • potassium voltage-gated channel, subfamily H (eag-related), member 5
  • voltage-gated potassium channel subunit Kv10.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84935
Species: Hu
Applications: IHC, IHC-P
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-85137
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NBP3-17510
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NBP1-81776
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-80516
Species: Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-84112
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47606
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
NBP2-45610
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-33284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-10480
Species: Hu
Applications: IHC, WB
H00055079-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-75552
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-83132
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Kv10.2 Antibody (NBP2-83132) (0)

There are no publications for Kv10.2 Antibody (NBP2-83132).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv10.2 Antibody (NBP2-83132) (0)

There are no reviews for Kv10.2 Antibody (NBP2-83132). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv10.2 Antibody (NBP2-83132) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv10.2 Products

Bioinformatics Tool for Kv10.2 Antibody (NBP2-83132)

Discover related pathways, diseases and genes to Kv10.2 Antibody (NBP2-83132). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv10.2 Antibody (NBP2-83132)

Discover more about diseases related to Kv10.2 Antibody (NBP2-83132).
 

Pathways for Kv10.2 Antibody (NBP2-83132)

View related products by pathway.

PTMs for Kv10.2 Antibody (NBP2-83132)

Learn more about PTMs related to Kv10.2 Antibody (NBP2-83132).
 

Research Areas for Kv10.2 Antibody (NBP2-83132)

Find related products by research area.

Blogs on Kv10.2

There are no specific blogs for Kv10.2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv10.2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNH5