Roquin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Roquin Antibody [NBP1-89589] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Roquin Antibody [NBP1-89589] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Roquin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPSAPEPAPPYLDHYPPYLQERVVNSQYGTQPQQYPPIYPSHYDGRRVYPAPSYTREEIFRESPIPIEIPPAAVPSYVPESRERYQQIESYYPVAPHPTQIRP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RC3H1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Roquin Protein (NBP1-89589PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Roquin Antibody

  • KIAA2025RP5-1198E17.5
  • RING finger and C3H zinc finger protein 1
  • ring finger and CCCH-type domains 1
  • RING finger protein 198
  • RNF198ring finger and CCCH-type zinc finger domains 1
  • roquin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12499
Species: Hu
Applications: IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-55172
Species: Hu
Applications: WB
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
AF4779
Species: Hu
Applications: WB, IHC
594-ML/CF
Species: Mu
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for Roquin Antibody (NBP1-89589) (0)

There are no publications for Roquin Antibody (NBP1-89589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Roquin Antibody (NBP1-89589) (0)

There are no reviews for Roquin Antibody (NBP1-89589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Roquin Antibody (NBP1-89589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Roquin Products

Bioinformatics Tool for Roquin Antibody (NBP1-89589)

Discover related pathways, diseases and genes to Roquin Antibody (NBP1-89589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Roquin Antibody (NBP1-89589)

Discover more about diseases related to Roquin Antibody (NBP1-89589).
 

Pathways for Roquin Antibody (NBP1-89589)

View related products by pathway.

PTMs for Roquin Antibody (NBP1-89589)

Learn more about PTMs related to Roquin Antibody (NBP1-89589).

Blogs on Roquin

There are no specific blogs for Roquin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Roquin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RC3H1