MNAB Antibody

Images

 
Western Blot: MNAB Antibody [NBP2-13212] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: MNAB Antibody [NBP2-13212] - Immunofluorescent staining of human cell line HeLa shows localization to cytosol.
Immunohistochemistry-Paraffin: MNAB Antibody [NBP2-13212] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MNAB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GAISRSSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYG NEATSSAHYVERDRFIVTDLSGHRKHSSTGDLLSLELQQAKSNSLLLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RC3H2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MNAB Protein (NBP2-13212PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MNAB Antibody

  • FLJ20301
  • FLJ20713
  • membrane associated DNA binding protein
  • membrane-associated nucleic acid binding protein
  • Membrane-associated nucleic acid-binding protein
  • MGC52176
  • MNAB
  • ring finger and CCCH-type domains 2
  • RING finger and CCCH-type zinc finger domain-containing protein 2
  • ring finger and CCCH-type zinc finger domains 2
  • RNF164RING finger protein 164

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-655
Species: Hu, Mu
Applications: WB, IP
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
H00055802-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP2-46132
Species: Hu
Applications: WB, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-13212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MNAB Antibody (NBP2-13212) (0)

There are no publications for MNAB Antibody (NBP2-13212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MNAB Antibody (NBP2-13212) (0)

There are no reviews for MNAB Antibody (NBP2-13212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MNAB Antibody (NBP2-13212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MNAB Products

Bioinformatics Tool for MNAB Antibody (NBP2-13212)

Discover related pathways, diseases and genes to MNAB Antibody (NBP2-13212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for MNAB Antibody (NBP2-13212)

Find related products by research area.

Blogs on MNAB

There are no specific blogs for MNAB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MNAB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RC3H2