MNAB Antibody - BSA Free

Western Blot: MNAB Antibody [NBP2-13212] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)

Immunohistochemistry-Paraffin: MNAB Antibody [NBP2-13212] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: MNAB Antibody [NBP2-13212] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Immunohistochemistry-Paraffin: MNAB Antibody [NBP2-13212] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Staining of human cerebellum shows weak cytoplasmic positivity in Purkinje cells.

Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Staining of human cell line HeLa shows localization to vesicles.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MNAB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MNAB Antibody - BSA Free (NBP2-13212) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GAISRSSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATSSAHYVERDRFIVTDLSGHRKHSSTGDLLSLELQQAKSNSLLLQ
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RC3H2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MNAB Protein (NBP2-13212PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MNAB Antibody - BSA Free

• FLJ20301
• FLJ20713
• membrane associated DNA binding protein
• membrane-associated nucleic acid binding protein
• Membrane-associated nucleic acid-binding protein
• MGC52176
• MNAB
• ring finger and CCCH-type domains 2
• RING finger and CCCH-type zinc finger domain-containing protein 2
• ring finger and CCCH-type zinc finger domains 2
• RNF164RING finger protein 164

Background

MNAB - membrane associated DNA binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RC3H2