![Immunohistochemistry-Paraffin: RNF43 Antibody [NBP1-85018] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/RNF43-Antibody-Immunohistochemistry-Paraffin-NBP1-85018-img0008.jpg "Immunohistochemistry-Paraffin: RNF43 Antibody [NBP1-85018] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSHLQSTSQH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RNF43 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC,HIER pH6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Block_Neutralize_1519.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_22159.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_6888.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RNF43 Antibody (NBP1-85018)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RNF43 |
![Immunohistochemistry-Paraffin: RNF43 Antibody [NBP1-85018] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RNF43-Antibody-Immunohistochemistry-Paraffin-NBP1-85018-img0005.jpg "Immunohistochemistry-Paraffin: RNF43 Antibody [NBP1-85018] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RNF43 Antibody [NBP1-85018] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RNF43-Antibody-Immunohistochemistry-Paraffin-NBP1-85018-img0006.jpg "Immunohistochemistry-Paraffin: RNF43 Antibody [NBP1-85018] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RNF43 Antibody [NBP1-85018] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/RNF43-Antibody-Immunohistochemistry-Paraffin-NBP1-85018-img0007.jpg "Immunohistochemistry-Paraffin: RNF43 Antibody [NBP1-85018] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: RNF43 Antibody [NBP1-85018] -Analysis in human cell lines Caco-2 and U-251MG using Anti-RNF43 antibody. Corresponding RNF43 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/antibody/nbp1-85018_rabbit-polyclonal-rnf43-antibody-western-blot-214202595250..png "Western Blot: RNF43 Antibody [NBP1-85018] -Analysis in human cell lines Caco-2 and U-251MG using Anti-RNF43 antibody. Corresponding RNF43 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")