RNF43 Antibody

Images

 
Immunohistochemistry-Paraffin: RNF43 Antibody [NBP1-85018] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF43 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSHLQSTSQH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
RNF43 Protein (NBP1-85018PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF43 Antibody

  • DKFZp781H02126
  • DKFZp781H0392
  • FLJ20315
  • FLJ77466
  • FLJ99338
  • MGC125630
  • ring finger protein 43
  • RNF124
  • RNF43
  • URCC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00892
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-85025
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4820
Species: Hu
Applications: WB, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-79140
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
8328-RF
Species: Mu
H00051132-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31730
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-85018
Species: Hu
Applications: IHC, IHC-P

Publications for RNF43 Antibody (NBP1-85018) (0)

There are no publications for RNF43 Antibody (NBP1-85018).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF43 Antibody (NBP1-85018) (0)

There are no reviews for RNF43 Antibody (NBP1-85018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNF43 Antibody (NBP1-85018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF43 Products

Bioinformatics Tool for RNF43 Antibody (NBP1-85018)

Discover related pathways, diseases and genes to RNF43 Antibody (NBP1-85018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF43 Antibody (NBP1-85018)

Discover more about diseases related to RNF43 Antibody (NBP1-85018).
 

Pathways for RNF43 Antibody (NBP1-85018)

View related products by pathway.

PTMs for RNF43 Antibody (NBP1-85018)

Learn more about PTMs related to RNF43 Antibody (NBP1-85018).

Blogs on RNF43

There are no specific blogs for RNF43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF43
Entrez