HJURP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HJURP Antibody [NBP1-85025] - Staining of human cell line A-431 shows positivity in nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human testis shows moderate to strong nuclear positivity in some spermatogonia cells.

Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells.

Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human skin shows moderate nuclear positivity in a subset of basal cells in squamous epithelium.

Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human stomach shows moderate nuclear positivity in lymphoid cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HJURP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HJURP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
• Control Peptide:

  HJURP Protein (NBP1-85025PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24039914)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HJURP Antibody - BSA Free

• FAKTS14-3-3-associated AKT substrate
• fetal liver expressing gene 1
• Fetal liver-expressing gene 1 protein
• FLEG1
• hFLEG1
• Holliday junction recognition protein
• Up-regulated in lung cancer 9
• URLC9DKFZp762E1312

Background

Centromeric protein that plays a central role in the incorporation and maintenance of histone H3-like variant CENPA at centromeres. Acts as a specific chaperone for CENPA and is required for the incorporation of newly synthesized CENPA molecules into nucleosomes at replicated centromeres. Directly binds Holliday junctions

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HJURP Antibody (NBP1-85025)(3)

Publications using NBP1-85025

• de Tayrac M, Saikali S, Aubry M et al. Prognostic Significance of EDN/RB, HJURP, p60/CAF-1 and PDLI4, Four New Markers in High-Grade Gliomas. PLoS One 2013-01-01 [PMID: 24039914]
• Hu Z, Huang G, Sadanandam A et al. The expression level of HJURP has an independent prognostic impact and predicts the sensitivity to radiotherapy in breast cancer. Breast Cancer Res 2010-01-01 [PMID: 20211017]
• Shuaib M, Ouararhni K, Dimitrov S et al. HJURP binds CENP-A via a highly conserved N-terminal domain and mediates its deposition at centromeres. Proc Natl Acad Sci U S A 2010-01-01 [PMID: 20080577]

Bioinformatics

• Gene Symbol: HJURP