HJURP Antibody

Images

 
Western Blot: HJURP Antibody [NBP1-85025] - Analysis in human cell line WM-115.
Immunocytochemistry/ Immunofluorescence: HJURP Antibody [NBP1-85025] - Staining of human cell line A-431 shows positivity in nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human testis shows moderate to strong nuclear positivity in some spermatogonia cells.
Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human lymph node shows moderate to strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human skin shows moderate nuclear positivity in a subset of basal cells in squamous epithelium.
Immunohistochemistry-Paraffin: HJURP Antibody [NBP1-85025] - Staining of human stomach shows moderate nuclear positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HJURP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRV
Specificity
Specificity of human HJURP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HJURP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
HJURP Protein (NBP1-85025PEP)
Publications
Read Publications using NBP1-85025.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24039914)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HJURP Antibody

  • FAKTS14-3-3-associated AKT substrate
  • fetal liver expressing gene 1
  • Fetal liver-expressing gene 1 protein
  • FLEG1
  • hFLEG1
  • Holliday junction recognition protein
  • Up-regulated in lung cancer 9
  • URLC9DKFZp762E1312

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-00892
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF4820
Species: Hu
Applications: WB, IHC
NBP1-85018
Species: Hu
Applications: IHC, IHC-P
H00008294-P01
Species: Hu
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
H00008363-P01
Species: Hu
H00008362-P01
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-66943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85025
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HJURP Antibody (NBP1-85025)(3)

Reviews for HJURP Antibody (NBP1-85025) (0)

There are no reviews for HJURP Antibody (NBP1-85025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HJURP Antibody (NBP1-85025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HJURP Antibody (NBP1-85025)

Discover related pathways, diseases and genes to HJURP Antibody (NBP1-85025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HJURP Antibody (NBP1-85025)

Discover more about diseases related to HJURP Antibody (NBP1-85025).
 

Pathways for HJURP Antibody (NBP1-85025)

View related products by pathway.

PTMs for HJURP Antibody (NBP1-85025)

Learn more about PTMs related to HJURP Antibody (NBP1-85025).

Blogs on HJURP

There are no specific blogs for HJURP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HJURP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HJURP