| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit HA95/AKAP8L Antibody - BSA Free (NBP2-47440) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-HA95/AKAP8L Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DEEGKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTAD |
| Predicted Species | Mouse (92%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AKAP8L |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-47440 | Applications | Species |
|---|---|---|
| Zhang R, Liu L, Wang F et al. AKAP8L enhances the stemness and chemoresistance of gastric cancer cells by stabilizing SCD1 mRNA Research Square 2022-08-25 [PMID: 36522343] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for HA95/AKAP8L Antibody (NBP2-47440)Find related products by research area.
|
|
HA95: Regulator of Nuclear Envelope Dynamics HA95 is a nuclear protein with high homology to the nuclear A-kinase anchoring protein AKAP95, involved in the regulation of nuclear envelope-chromatin interactions. Antibody immunostaining data indicate that HA95 is tightly associated with chromatin ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AKAP8L |