HA95/AKAP8L Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining in human testis and liver tissues using anti-AKAP8L antibody. Corresponding AKAP8L RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human cerebral cortex, colon, kidney and testis using Anti-AKAP8L antibody NBP2-47440 (A) shows similar ...read more
Western Blot: HA95/AKAP8L Antibody [NBP2-47440] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: HA95/AKAP8L Antibody [NBP2-47440] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human colon.
Immunohistochemistry-Paraffin: HA95/AKAP8L Antibody [NBP2-47440] - Staining of human kidney.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HA95/AKAP8L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DEEGKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTAD
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP8L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HA95/AKAP8L Protein (NBP2-47440PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HA95/AKAP8L Antibody

  • A kinase (PRKA) anchor protein 8-like
  • AKAP8-like protein
  • HA95
  • HAP95 DKFZp434L0650
  • helicase A-binding protein 95 kDa
  • Homologous to AKAP95 protein
  • HRIHFB2018
  • NAKAP
  • NAKAP95 A-kinase anchor protein 8-like
  • neighbor of A kinase anchoring protein 95
  • Neighbor of AKAP95
  • Neighbor of A-kinase-anchoring protein 95

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010270-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89172
Species: Hu
Applications: IHC, IHC-P, WB
NB110-40579
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-22128
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-75477
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP2-38713
Species: Hu
Applications: IHC, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00000053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-87822
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-67635
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
NBP2-13968
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for HA95/AKAP8L Antibody (NBP2-47440) (0)

There are no publications for HA95/AKAP8L Antibody (NBP2-47440).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HA95/AKAP8L Antibody (NBP2-47440) (0)

There are no reviews for HA95/AKAP8L Antibody (NBP2-47440). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HA95/AKAP8L Antibody (NBP2-47440) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HA95/AKAP8L Products

Bioinformatics Tool for HA95/AKAP8L Antibody (NBP2-47440)

Discover related pathways, diseases and genes to HA95/AKAP8L Antibody (NBP2-47440). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HA95/AKAP8L Antibody (NBP2-47440)

Discover more about diseases related to HA95/AKAP8L Antibody (NBP2-47440).
 

Pathways for HA95/AKAP8L Antibody (NBP2-47440)

View related products by pathway.

PTMs for HA95/AKAP8L Antibody (NBP2-47440)

Learn more about PTMs related to HA95/AKAP8L Antibody (NBP2-47440).
 

Research Areas for HA95/AKAP8L Antibody (NBP2-47440)

Find related products by research area.

Blogs on HA95/AKAP8L.

HA95: Regulator of Nuclear Envelope Dynamics
HA95 is a nuclear protein with high homology to the nuclear A-kinase anchoring protein AKAP95, involved in the regulation of nuclear envelope-chromatin interactions. Antibody immunostaining data indicate that HA95 is tightly associated with chromatin ...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HA95/AKAP8L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP8L