ZNRF3 Antibody - BSA Free

Western Blot: ZNRF3 Antibody [NBP3-03924] - Analysis of extracts of Mouse testis, using ZNRF3 antibody at 1:3416 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: ZNRF3 Antibody [NBP3-03924] - Rat lung using ZNRF3 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: ZNRF3 Antibody [NBP3-03924] - Human liver using ZNRF3 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: ZNRF3 Antibody [NBP3-03924] - Mouse spleen using ZNRF3 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNRF3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNRF3 Antibody - BSA Free (NBP3-03924) is a polyclonal antibody validated for use in IHC, WB and ELISA. Anti-ZNRF3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ZNRF3 (NP_001193927.1). MHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNRF3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 100 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNRF3 Antibody - BSA Free

• BK747E2.3
• KIAA1133
• novel C3HC4 type Zinc finger (ring finger)
• RNF203
• zinc and ring finger 3
• zinc/RING finger protein 3
• ZNRF3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNRF3 Antibody (NBP3-03924)(1)

Publication using NBP3-03924

• Wang Z, Wang Y, Ma X, Dang C RSPO2 silence inhibits tumorigenesis of nasopharyngeal carcinoma by ZNRF3/Hedgehog-Gli1 signal pathway Life sciences Jul 14 2021 [PMID: 34273374]

Bioinformatics

• Gene Symbol: ZNRF3