RNF40 Antibody - BSA Free

Western Blot: RNF40 Antibody [NBP2-54968] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: RNF40 Antibody [NBP2-54968] - Staining of human cell line HeLa shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNF40 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RNF40 Antibody - BSA Free (NBP2-54968) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF40
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RNF40 Recombinant Protein Antigen (NBP2-54968PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RNF40 Antibody - BSA Free

• 95 kDa retinoblastoma-associated protein
• BRE1-B
• BRE1BMGC13051
• EC 6.3.2,95 kDa retinoblastoma protein binding protein
• EC 6.3.2.-
• KIAA0661BRE1 E3 ubiquitin ligase homolog B
• Rb-associated protein
• RBP95E3 ubiquitin-protein ligase BRE1B
• ring finger protein 40DKFZp686K191
• STARING

Background

RNF40 is encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF40