Recombinant Human RNF130 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RNF130 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 28-127 of Human RNF130 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DNASQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RNF130

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RNF130 Protein

  • E3 ubiquitin-protein ligase RNF130
  • EC 2.1.1
  • EC 6.3.2
  • EC 6.3.2.-
  • g1-related zinc finger protein
  • G1RZFP
  • Goliath homolog
  • GOLIATH
  • GP
  • H-Goliath
  • MGC117241
  • MGC99542
  • ring finger protein 130MGC138647

Background

RNF130 - ring finger protein 130

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-76941
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-65904
Species: Hu, Ca, Md
Applications: Flow, IP
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for RNF130 Partial Recombinant Protein (H00055819-Q01) (0)

There are no publications for RNF130 Partial Recombinant Protein (H00055819-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF130 Partial Recombinant Protein (H00055819-Q01) (0)

There are no reviews for RNF130 Partial Recombinant Protein (H00055819-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF130 Partial Recombinant Protein (H00055819-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF130 Products

Bioinformatics Tool for RNF130 Partial Recombinant Protein (H00055819-Q01)

Discover related pathways, diseases and genes to RNF130 Partial Recombinant Protein (H00055819-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF130 Partial Recombinant Protein (H00055819-Q01)

Discover more about diseases related to RNF130 Partial Recombinant Protein (H00055819-Q01).
 

Pathways for RNF130 Partial Recombinant Protein (H00055819-Q01)

View related products by pathway.

PTMs for RNF130 Partial Recombinant Protein (H00055819-Q01)

Learn more about PTMs related to RNF130 Partial Recombinant Protein (H00055819-Q01).

Blogs on RNF130

There are no specific blogs for RNF130, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RNF130 Antibody
NBP1-81858

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RNF130 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF130