RNF10 Antibody

Images

 
Western Blot: RNF10 Antibody [NBP2-38672] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: RNF10 Antibody [NBP2-38672] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SPCYYFYQAEDGQHMFLHPVNVRCLVREYGSLERSPEKISATVVEIAGYSMSEDVRQRHRYLSHLPLTCEFSICELALQPPVV
Specificity
Specificity of human RNF10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
RNF10 Knockout 293T Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF10 Antibody

  • KIAA0262RIE2MGC126758
  • MGC126764
  • ring finger protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004223-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-84366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP2-24459
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
NB300-815
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-52553
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-59139
Species: Hu
Applications: WB, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38672
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RNF10 Antibody (NBP2-38672) (0)

There are no publications for RNF10 Antibody (NBP2-38672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF10 Antibody (NBP2-38672) (0)

There are no reviews for RNF10 Antibody (NBP2-38672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF10 Antibody (NBP2-38672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RNF10 Products

Bioinformatics Tool for RNF10 Antibody (NBP2-38672)

Discover related pathways, diseases and genes to RNF10 Antibody (NBP2-38672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF10 Antibody (NBP2-38672)

Discover more about diseases related to RNF10 Antibody (NBP2-38672).
 

Pathways for RNF10 Antibody (NBP2-38672)

View related products by pathway.

Research Areas for RNF10 Antibody (NBP2-38672)

Find related products by research area.

Blogs on RNF10

There are no specific blogs for RNF10, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF10
Uniprot
COVID-19 update