RNase H1 Antibody

Images

 
Western Blot: RNase H1 Antibody [NBP1-80448] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: RNase H1 Antibody [NBP1-80448] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
LYOPH

Order Details

RNase H1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human RNASEH1. Peptide sequence EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNASEH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RNASEH1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Concentration
LYOPH
Purity
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNase H1 Antibody

  • EC 3.1.26.4
  • H1RNA
  • Ribonuclease H type II
  • ribonuclease H1
  • RNase H1
  • RNH1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-87804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91872
Species: Hu
Applications: IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, ICC, KO
NB100-119
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-90365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80448
Species: Hu
Applications: WB

Publications for RNase H1 Antibody (NBP1-80448) (0)

There are no publications for RNase H1 Antibody (NBP1-80448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNase H1 Antibody (NBP1-80448) (0)

There are no reviews for RNase H1 Antibody (NBP1-80448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNase H1 Antibody (NBP1-80448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RNase H1 Antibody (NBP1-80448)

Discover related pathways, diseases and genes to RNase H1 Antibody (NBP1-80448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNase H1 Antibody (NBP1-80448)

Discover more about diseases related to RNase H1 Antibody (NBP1-80448).
 

Pathways for RNase H1 Antibody (NBP1-80448)

View related products by pathway.

PTMs for RNase H1 Antibody (NBP1-80448)

Learn more about PTMs related to RNase H1 Antibody (NBP1-80448).

Blogs on RNase H1

There are no specific blogs for RNase H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNase H1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASEH1
Uniprot