RIOK3 Antibody (3G11)

Images

 
Western Blot: RIOK3 Antibody (3G11) [H00008780-M02] - RIOK3 monoclonal antibody (M02), clone 3G11 Analysis of RIOK3 expression in K-562.
Western Blot: RIOK3 Antibody (3G11) [H00008780-M02] - Analysis of RIOK3 over-expressed 293 cell line, cotransfected with RIOK3 Validated Chimera RNAi ( Cat # H00008780-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: RIOK3 Antibody (3G11) [H00008780-M02] - Analysis of RIOK3 expression in transfected 293T cell line by RIOK3 monoclonal antibody (M02), clone 3G11.Lane 1: RIOK3 transfected lysate(59.1 KDa).Lane 2: ...read more
Sandwich ELISA: RIOK3 Antibody (3G11) [H00008780-M02] - Detection limit for recombinant GST tagged RIOK3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
3G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RIOK3 Antibody (3G11) Summary

Immunogen
RIOK3 (AAH39729 411 a.a. - 516 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Specificity
RIOK3 - RIO kinase 3 (yeast)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RIOK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RIOK3 Antibody (3G11)

  • DKFZp779L1370
  • EC 2.7.11.1
  • homolog of the Aspergillus nidulans sudD gene product
  • RIO kinase 3 (yeast)
  • RIO kinase 3
  • serine/threonine-protein kinase RIO3
  • sudD (suppressor of bimD6, Aspergillus nidulans) homolog
  • sudD homolog
  • sudD suppressor of bimD6 homolog
  • SUDDsudD suppressor of Aspergillus nidulans bimD6 homolog

Background

This gene was identified by the similarity of its product to the Aspergillus nidulans SUDD protein, an extragenic suppressor of the heat-sensitive bimD6 mutation that fails to attach properly to the spindle microtubules at a restrictive temperature. The specific function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46466
Species: Hu
Applications: IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46316
Species: Hu
Applications: WB, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-30954
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF2119
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for RIOK3 Antibody (H00008780-M02) (0)

There are no publications for RIOK3 Antibody (H00008780-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIOK3 Antibody (H00008780-M02) (0)

There are no reviews for RIOK3 Antibody (H00008780-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIOK3 Antibody (H00008780-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIOK3 Products

Bioinformatics Tool for RIOK3 Antibody (H00008780-M02)

Discover related pathways, diseases and genes to RIOK3 Antibody (H00008780-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIOK3 Antibody (H00008780-M02)

Discover more about diseases related to RIOK3 Antibody (H00008780-M02).
 

Pathways for RIOK3 Antibody (H00008780-M02)

View related products by pathway.

PTMs for RIOK3 Antibody (H00008780-M02)

Learn more about PTMs related to RIOK3 Antibody (H00008780-M02).
 

Research Areas for RIOK3 Antibody (H00008780-M02)

Find related products by research area.

Blogs on RIOK3

There are no specific blogs for RIOK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIOK3 Antibody (3G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol RIOK3
Entrez
OMIM
Uniprot