STX18 Antibody (2E5)

Images

 
Western Blot: STX18 Antibody (2E5) [H00053407-M13] - Analysis of STX18 expression in PC-12 (Cat # L012V1).
Immunohistochemistry-Paraffin: STX18 Antibody (2E5) [H00053407-M13] - Analysis of monoclonal antibody to STX18 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml
Western Blot: STX18 Antibody (2E5) [H00053407-M13] - Analysis of STX18 expression in Raw 264.7 (Cat # L024V1).
Sandwich ELISA: STX18 Antibody (2E5) [H00053407-M13] - Detection limit for recombinant GST tagged STX18 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
2E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

STX18 Antibody (2E5) Summary

Immunogen
STX18 (NP_058626, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPA
Specificity
Reacts with syntaxin 18.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STX18
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STX18 Antibody (2E5)

  • Cell growth-inhibiting gene 9 protein
  • DKFZp686O15149
  • syntaxin 18
  • syntaxin-18
  • Ufe1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82785
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46580
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-82312
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91277
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-02031
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-82245
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
AF5687
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-83254
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14335
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38751
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85911
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87439
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32493
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB6117
Species: Hu
Applications: IHC, WB
NBP2-33414
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00053407-M13
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for STX18 Antibody (H00053407-M13) (0)

There are no publications for STX18 Antibody (H00053407-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STX18 Antibody (H00053407-M13) (0)

There are no reviews for STX18 Antibody (H00053407-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STX18 Antibody (H00053407-M13). (Showing 1 - 1 of 1 FAQ).

  1. Could you please tell me the recommended dilution ratio for WB for this product or at least a starting point that you recommend for H00053407-M13?
    • H00053407-M13 is manufactured by Abnova and their product page just points you towards their general protocol and does not list and specifics.http://www.abnova.com/products/products_detail.asp?catalog_id=H00053407-M13#p00According to their general protocol, their mouse monoclonal antibodies (Mouse Ig) are recommended at a concentration of 1-5 ug/ml.See table 2: http://www.abnova.com/protocol_pdf/Western_Blot.pdf

Secondary Antibodies

 

Isotype Controls

Additional STX18 Products

Bioinformatics Tool for STX18 Antibody (H00053407-M13)

Discover related pathways, diseases and genes to STX18 Antibody (H00053407-M13). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STX18 Antibody (H00053407-M13)

Discover more about diseases related to STX18 Antibody (H00053407-M13).
 

Pathways for STX18 Antibody (H00053407-M13)

View related products by pathway.

PTMs for STX18 Antibody (H00053407-M13)

Learn more about PTMs related to STX18 Antibody (H00053407-M13).

Blogs on STX18

There are no specific blogs for STX18, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STX18 Antibody (2E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol STX18
Entrez
Uniprot