STX18 Antibody (2E5) Summary
Immunogen |
STX18 (NP_058626, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPA |
Specificity |
Reacts with syntaxin 18. |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
STX18 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot
|
Application Notes |
This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for STX18 Antibody (2E5)
Background
Syntaxin that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for STX18 Antibody (H00053407-M13) (0)
There are no publications for STX18 Antibody (H00053407-M13).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STX18 Antibody (H00053407-M13) (0)
There are no reviews for STX18 Antibody (H00053407-M13).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for STX18 Antibody (H00053407-M13). (Showing 1 - 1 of 1 FAQ).
-
Could you please tell me the recommended dilution ratio for WB for this product or at least a starting point that you recommend for H00053407-M13?
- H00053407-M13 is manufactured by Abnova and their product page just points you towards their general protocol and does not list and specifics.http://www.abnova.com/products/products_detail.asp?catalog_id=H00053407-M13#p00According to their general protocol, their mouse monoclonal antibodies (Mouse Ig) are recommended at a concentration of 1-5 ug/ml.See table 2: http://www.abnova.com/protocol_pdf/Western_Blot.pdf
Secondary Antibodies
| |
Isotype Controls
|
Additional STX18 Products
Bioinformatics Tool for STX18 Antibody (H00053407-M13)
Discover related pathways, diseases and genes to STX18 Antibody (H00053407-M13). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for STX18 Antibody (H00053407-M13)
Discover more about diseases related to STX18 Antibody (H00053407-M13).
| | Pathways for STX18 Antibody (H00053407-M13)
View related products by pathway.
|
PTMs for STX18 Antibody (H00053407-M13)
Learn more about PTMs related to STX18 Antibody (H00053407-M13).
|
Blogs on STX18