Ribophorin I Antibody

Images

 
Western Blot: ribophorin I Antibody [NBP1-69260] - This Anti-RPN1 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ribophorin I Antibody Summary

Immunogen
Synthetic peptides corresponding to RPN1(ribophorin I) The peptide sequence was selected from the N terminal of Ribophorin I. Peptide sequence TSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRF.
Specificity
This product is specific to Subunit or Isofrom: 1.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RPN1 and was validated on Western blot.
Theoretical MW
69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ribophorin I Antibody

  • DKFZp686B16177
  • dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit
  • Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit
  • dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
  • EC 2.4.1.119
  • oligosaccharyltransferase 1 homolog
  • OST1
  • ribophorin IRBPH1
  • ribophorin-1
  • RPN-I

Background

Ribophorin I is a type I integral membrane protein found only in the rough endoplasmic reticulum. It is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. Ribophorin I forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46439
Species: Hu
Applications: WB, IHC
NBP1-80835
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NB600-669
Species: Hu, Mu
Applications: WB, ICC/IF
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC-P
AF6295
Species: Hu, Mu
Applications: WB, IHC
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-31660
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-30447
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
H00029978-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56536
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ribophorin I Antibody (NBP1-69260) (0)

There are no publications for Ribophorin I Antibody (NBP1-69260).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ribophorin I Antibody (NBP1-69260) (0)

There are no reviews for Ribophorin I Antibody (NBP1-69260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ribophorin I Antibody (NBP1-69260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ribophorin I Products

Bioinformatics Tool for Ribophorin I Antibody (NBP1-69260)

Discover related pathways, diseases and genes to Ribophorin I Antibody (NBP1-69260). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ribophorin I Antibody (NBP1-69260)

Discover more about diseases related to Ribophorin I Antibody (NBP1-69260).
 

Pathways for Ribophorin I Antibody (NBP1-69260)

View related products by pathway.

PTMs for Ribophorin I Antibody (NBP1-69260)

Learn more about PTMs related to Ribophorin I Antibody (NBP1-69260).

Blogs on Ribophorin I

There are no specific blogs for Ribophorin I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ribophorin I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPN1