Ribophorin I Antibody - BSA Free

Western Blot: ribophorin I Antibody [NBP1-69260] - This Anti-RPN1 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

• Reactivity: Ca
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Ribophorin I Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RPN1(ribophorin I) The peptide sequence was selected from the N terminal of Ribophorin I. Peptide sequence TSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRF. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 69 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Ribophorin I Antibody - BSA Free

• DKFZp686B16177
• dolichyl-diphosphooligosaccharide-protein glycosyltransferase 67 kDa subunit
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67 kDa subunit
• dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
• EC 2.4.1.119
• oligosaccharyltransferase 1 homolog
• OST1
• ribophorin IRBPH1
• ribophorin-1
• RPN-I

Background

Ribophorin I is a type I integral membrane protein found only in the rough endoplasmic reticulum. It is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. Ribophorin I forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPN1