RHPN1 Antibody

Images

 
Western Blot: RHPN1 Antibody [NBP1-55003] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHPN1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RHPN1(rhophilin, Rho GTPase binding protein 1) The peptide sequence was selected from the middle region of RHPN1. Peptide sequence SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHPN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RHPN1 and was validated on Western blot.
Theoretical MW
73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RHPN1 Antibody

  • GTP-Rho-binding protein 1
  • KIAA1929outer dense fiber of sperm tails 5
  • ODF5
  • rhophilin 1
  • RHOPHILIN
  • rhophilin, Rho GTPase binding protein 1
  • rhophilin-1
  • RHPN

Background

RHPN1has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB600-792
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-88956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
21050002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-84420
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49557
Species: Hu
Applications: IHC, IHC-P
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00054504-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for RHPN1 Antibody (NBP1-55003) (0)

There are no publications for RHPN1 Antibody (NBP1-55003).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHPN1 Antibody (NBP1-55003) (0)

There are no reviews for RHPN1 Antibody (NBP1-55003). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHPN1 Antibody (NBP1-55003) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHPN1 Products

Bioinformatics Tool for RHPN1 Antibody (NBP1-55003)

Discover related pathways, diseases and genes to RHPN1 Antibody (NBP1-55003). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RHPN1 Antibody (NBP1-55003)

Find related products by research area.

Blogs on RHPN1

There are no specific blogs for RHPN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHPN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHPN1
Uniprot