RhoGAP Antibody - BSA Free

Western Blot: RhoGAP Antibody [NBP2-88152] - Host: Rabbit. Target Name: RHG05. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RhoGAP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RhoGAP Antibody - BSA Free (NBP2-88152) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RhoGAP. Peptide sequence: YLSDNTRESTHQSEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RhoGAP Antibody - BSA Free

• growth factor independent 2
• p100 RasGAP-associated p105 protein
• p105 RhoGAP
• p190-BGFI2
• p190BRhoGAP
• Rho GTPase activating protein 5
• rho GTPase-activating protein 5
• RHOGAP5
• Rho-type GTPase-activating protein 5

Background

The p190 Rho GTPase activating protein RhoGAP) family includes two closely related proteins, p190-A and p190-B. p190-B contains an N-terminal GTPase domain and a C-terminal Rho-GAP domain (1). p190-B can be directly phosphorylated on a single identified tyrosine residue by the activated insulin and IGF-1 receptors. This phosphorylation causes p190-B to translocate to the lipid rafts of the plasma membrane, where it can facilitate the inactivation of the Rho GTPase. P190-B also has been shown to be tyrosine phosphorylated by c-Src and v-Src. Additionall; the GAP domain of p190-B as shown to attenuate signal-transducing activity of Rac, Rho and CDC42 (2-3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP5