RHBG Antibody

Images

 
Western Blot: RHBG Antibody [NBP2-59022] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: RHBG Antibody [NBP2-59022] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHBG Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ATHEAYGDGLESVFPLIAEGQRSATSQAMHQL
Specificity
Specificity of human RHBG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHBG
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RHBG Recombinant Protein Antigen (NBP2-59022PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RHBG Antibody

  • ammonium transporter Rh type B
  • Rh family type B glycoprotein
  • Rh family, B glycoprotein (gene/pseudogene)
  • Rh type B glycoprotein
  • Rhesus blood group family type B glycoprotein
  • Rhesus blood group, B glycoprotein
  • SLC42A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP1-52089
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-49180
Species: Hu
Applications: IHC, IHC-P
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF3814
Species: Hu, Mu, Rt
Applications: WB, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB110-81529
Species: Hu, Mu, Rt, Po, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-82576
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP1-90226
Species: Hu
Applications: IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58275
Species: Hu
Applications: WB, ICC/IF

Publications for RHBG Antibody (NBP2-59022) (0)

There are no publications for RHBG Antibody (NBP2-59022).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHBG Antibody (NBP2-59022) (0)

There are no reviews for RHBG Antibody (NBP2-59022). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RHBG Antibody (NBP2-59022) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RHBG Antibody (NBP2-59022)

Discover related pathways, diseases and genes to RHBG Antibody (NBP2-59022). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHBG Antibody (NBP2-59022)

Discover more about diseases related to RHBG Antibody (NBP2-59022).
 

Pathways for RHBG Antibody (NBP2-59022)

View related products by pathway.

PTMs for RHBG Antibody (NBP2-59022)

Learn more about PTMs related to RHBG Antibody (NBP2-59022).

Blogs on RHBG

There are no specific blogs for RHBG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHBG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHBG