RFXAP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RFXAP Antibody [NBP2-58217] - Staining of human cell line HEK 293 shows localization to nuclear speckles.

ChIP-Exo-Seq composite graph for Anti-RFXAP (NBP2-58217) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RFXAP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RFXAP Antibody - BSA Free (NBP2-58217) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFXAP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RFXAP Recombinant Protein Antigen (NBP2-58217PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RFXAP Antibody - BSA Free

• regulatory factor X-associated protein
• RFX DNA-binding complex 36 kDa subunit
• RFX-associated protein

Background

The identification of transacting factors controlling major histocompatibility complex (MHC) class II gene transcription via the proximal enhancer of the promoter has been greatly facilitated by a genetic approach, namely, the analysis of cell lines that are characterized by regulatory defects abolishing transcription of these genes (Mach et al., 1996). Most of these MHC class II regulatory mutants are cell lines derived from patients suffering from MHC class II deficiency, also referred to as the bare lymphocyte syndrome type II, a rare autosomal recessive disorder characterized by the lack of constitutive and inducible MHC class II expression in all cell types and tissues. The genetic lesions responsible for this lack of expression lie not in MHC class II genes themselves, but in transacting regulatory genes required for their transcription (Mach et al., 1996). Durand et al. (1997) noted that at least 3 different complementation groups (groups A, B, and C) have been identified by means of somatic cell fusion experiments. the defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC class II promoters Durand et al. (1997) isolated a novel gene that encodes the 36-kD subunit of RFX. They called this subunit RFX-associated protein (RFXAP) because it is a subunit of the RFX complex and interacts with RFX5, yet it does not contain the characteristic RFX DNA-binding motif.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFXAP