RFTN2 Antibody

Images

 
Western Blot: RFTN2 Antibody [NBP1-57042] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFTN2 Antibody Summary

Immunogen
Synthetic peptides corresponding to RFTN2 (raftlin family member 2) The peptide sequence was selected from the N terminal of RFTN2. Peptide sequence MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFTN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RFTN2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RFTN2 Antibody

  • C2orf11
  • chromosome 2 open reading frame 11
  • FLJ30574
  • MGC117313
  • raftlin family member 2
  • Raftlin-2
  • Raft-linking protein 2

Background

The function of the protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81889
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-86306
Species: Hu
Applications: IHC, IHC-P
NBP1-21502
Species: Hu, Mu, Po, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-93499
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-44375
Species: Mu, Rt
Applications: WB, ICC/IF
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF1700
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
MAB8175
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-21402
Species: Hu, Rt
Applications: WB, ICC/IF, IP
NBP1-57042
Species: Hu
Applications: WB

Publications for RFTN2 Antibody (NBP1-57042) (0)

There are no publications for RFTN2 Antibody (NBP1-57042).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFTN2 Antibody (NBP1-57042) (0)

There are no reviews for RFTN2 Antibody (NBP1-57042). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFTN2 Antibody (NBP1-57042) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RFTN2 Antibody (NBP1-57042)

Discover related pathways, diseases and genes to RFTN2 Antibody (NBP1-57042). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RFTN2 Antibody (NBP1-57042)

View related products by pathway.

Blogs on RFTN2

There are no specific blogs for RFTN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFTN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFTN2
Uniprot