RFC4 Antibody (1C12)

Images

 
Western Blot: RFC4 Antibody (1C12) [H00005984-M01] - RFC4 monoclonal antibody (M01), clone 1C12 Analysis of RFC4 expression in K-562.
Immunohistochemistry-Paraffin: RFC4 Antibody (1C12) [H00005984-M01] - Analysis of monoclonal antibody to RFC4 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Western Blot: RFC4 Antibody (1C12) [H00005984-M01] - Analysis of RFC4 over-expressed 293 cell line, cotransfected with RFC4 Validated Chimera RNAi ( Cat # H00005984-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: RFC4 Antibody (1C12) [H00005984-M01] - Analysis of RFC4 expression in transfected 293T cell line by RFC4 monoclonal antibody (M01), clone 1C12.Lane 1: RFC4 transfected lysate(39.7 KDa).Lane 2: ...read more
Sandwich ELISA: RFC4 Antibody (1C12) [H00005984-M01] - Detection limit for recombinant GST tagged RFC4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, RNAi
Clone
1C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RFC4 Antibody (1C12) Summary

Immunogen
RFC4 (AAH17452 254 a.a. - 363 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
Specificity
RFC4 - replication factor C (activator 1) 4, 37kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RFC4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RFC4 Antibody (1C12)

  • A1 37 kDa subunit
  • A1
  • Activator 1 37 kDa subunit
  • Activator 1 subunit 4
  • MGC27291
  • replication factor C (activator 1) 4, 37kDa
  • Replication factor C 37 kDa subunit
  • replication factor C subunit 4
  • RFC 37 kDa subunit
  • RF-C 37 kDa subunit
  • RFC37replication factor C (activator 1) 4 (37kD)

Background

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1936
Species: Hu
Applications: WB, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005984-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi

Publications for RFC4 Antibody (H00005984-M01) (0)

There are no publications for RFC4 Antibody (H00005984-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC4 Antibody (H00005984-M01) (0)

There are no reviews for RFC4 Antibody (H00005984-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFC4 Antibody (H00005984-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFC4 Products

Bioinformatics Tool for RFC4 Antibody (H00005984-M01)

Discover related pathways, diseases and genes to RFC4 Antibody (H00005984-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC4 Antibody (H00005984-M01)

Discover more about diseases related to RFC4 Antibody (H00005984-M01).
 

Pathways for RFC4 Antibody (H00005984-M01)

View related products by pathway.

PTMs for RFC4 Antibody (H00005984-M01)

Learn more about PTMs related to RFC4 Antibody (H00005984-M01).
 

Research Areas for RFC4 Antibody (H00005984-M01)

Find related products by research area.

Blogs on RFC4

There are no specific blogs for RFC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFC4 Antibody (1C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC4
Entrez
OMIM
Uniprot