retinol dehydrogenase 8 (all trans) Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: retinol dehydrogenase 8 (all trans) Antibody [NBP3-17534] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm, cytosol & midbody ring.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

retinol dehydrogenase 8 (all trans) Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit retinol dehydrogenase 8 (all trans) Antibody - BSA Free (NBP3-17534) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RDH8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for retinol dehydrogenase 8 (all trans) Antibody - BSA Free

• photoreceptor outer segment all-trans retinol dehydrogenase
• PRRDH
• retinol dehydrogenase 8 (all-trans)
• retinol dehydrogenase 8
• SDR28C2
• short chain dehydrogenase/reductase family 28C, member 2

Background

All-trans-retinol dehydrogenase (RDH8) is a visual cycle enzyme that reduces all-trans-retinal to all-trans-retinol in the presence of NADPH (Rattner et al., 2000 [PubMed 10753906]). It is a member of the short chain dehydrogenase/reductase family and is located in the outer segments of photoreceptors; hence it is also known as photoreceptor retinol dehydrogenase. It is important in the visual cycle by beginning the rhodopsin regeneration pathway by reducing all-trans-retinal, the product of bleached and hydrolysed rhodopsin (Rando, 2001 [PubMed 11710234]). This is a rate-limiting step in the visual cycle (Saari et al., 1998 [PubMed 9667000]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RDH8