Recombinant Human REM1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human REM1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 162-251 of Human REM1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
REM1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human REM1 Protein

  • GESGD:REM
  • GTPase GES
  • GTPase-regulating endothelial cell sprouting
  • GTP-binding protein REM 1
  • MGC48669
  • Rad and Gem-like GTP-binding protein 1
  • RAS (RAD and GEM)-like GTP-binding 1
  • RAS (RAD and GEM)-like GTP-binding
  • REM

Background

REM1 - RAS (RAD and GEM)-like GTP-binding 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB763
Species: Hu, Mu, Rt
Applications: IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00028954-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for REM1 Partial Recombinant Protein (H00028954-Q01) (0)

There are no publications for REM1 Partial Recombinant Protein (H00028954-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REM1 Partial Recombinant Protein (H00028954-Q01) (0)

There are no reviews for REM1 Partial Recombinant Protein (H00028954-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REM1 Partial Recombinant Protein (H00028954-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional REM1 Products

Bioinformatics Tool for REM1 Partial Recombinant Protein (H00028954-Q01)

Discover related pathways, diseases and genes to REM1 Partial Recombinant Protein (H00028954-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REM1 Partial Recombinant Protein (H00028954-Q01)

Discover more about diseases related to REM1 Partial Recombinant Protein (H00028954-Q01).
 

Pathways for REM1 Partial Recombinant Protein (H00028954-Q01)

View related products by pathway.

PTMs for REM1 Partial Recombinant Protein (H00028954-Q01)

Learn more about PTMs related to REM1 Partial Recombinant Protein (H00028954-Q01).
 

Research Areas for REM1 Partial Recombinant Protein (H00028954-Q01)

Find related products by research area.

Blogs on REM1

There are no specific blogs for REM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

REM1 Antibody
H00028954-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human REM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol REM1