Reg4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Reg4 Antibody [NBP2-38552] - Analysis in human duodenum and liver tissues. Corresponding Reg4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Reg4 Antibody [NBP2-38552] - Staining of human rectum shows moderate cytoplasmic positivity in goblet of cells.

Immunohistochemistry-Paraffin: Reg4 Antibody [NBP2-38552] - Staining of human duodenum shows strong positivity in mucus in goblet cells.

Immunohistochemistry-Paraffin: Reg4 Antibody [NBP2-38552] - Staining of human liver shows no positivity as expected.

Immunohistochemistry-Paraffin: Reg4 Antibody [NBP2-38552] - Staining of human stomach shows no positivity in a subset of glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Reg4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Reg4 Antibody - BSA Free (NBP2-38552) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: REG4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Reg4 Protein (NBP2-38552PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Reg4 Antibody - BSA Free

• Gastrointestinal secretory protein
• GISP
• GISPREG-4
• Reg IV
• Reg4
• regenerating gene type IV
• regenerating islet-derived family, member 4
• regenerating islet-derived protein 4
• Regenerating islet-derived protein IV
• REG-IV
• RELP
• RELPREG-like protein

Background

REG4 may be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: REG4
• Uniprot:
  • Q9BYZ8()