Reg3A Recombinant Protein Antigen

Images

 
There are currently no images for Reg3A Recombinant Protein Antigen (NBP2-56947PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Reg3A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human REG3A.

Source: E.coli

Amino Acid Sequence: YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
REG3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56947. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Reg3A Recombinant Protein Antigen

  • hepatocarcinoma-intestine-pancreas
  • HIPpancreatitis-associated protein
  • Human proislet peptide
  • Lithostathine 3
  • pancreatic beta cell growth factor
  • Pancreatitis-associated protein 1
  • PAP homologous protein
  • PAP1FLJ18565
  • PAP2
  • PAPPAP-H
  • PBCGF
  • proliferation-inducing protein 34
  • proliferation-inducing protein 42
  • Reg III-alpha
  • REG3
  • Reg3A
  • REG-3-alpha
  • regenerating islet-derived 3 alpha
  • regenerating islet-derived protein 3-alpha
  • Regenerating islet-derived protein III-alpha
  • REG-III

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-43686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79286
Species: Rt
Applications: WB
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
DSE100
Species: Hu
Applications: ELISA
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
AF4478
Species: Hu
Applications: IHC, WB

Publications for Reg3A Recombinant Protein Antigen (NBP2-56947PEP) (0)

There are no publications for Reg3A Recombinant Protein Antigen (NBP2-56947PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reg3A Recombinant Protein Antigen (NBP2-56947PEP) (0)

There are no reviews for Reg3A Recombinant Protein Antigen (NBP2-56947PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Reg3A Recombinant Protein Antigen (NBP2-56947PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Reg3A Products

Bioinformatics Tool for Reg3A Recombinant Protein Antigen (NBP2-56947PEP)

Discover related pathways, diseases and genes to Reg3A Recombinant Protein Antigen (NBP2-56947PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reg3A Recombinant Protein Antigen (NBP2-56947PEP)

Discover more about diseases related to Reg3A Recombinant Protein Antigen (NBP2-56947PEP).
 

Pathways for Reg3A Recombinant Protein Antigen (NBP2-56947PEP)

View related products by pathway.

PTMs for Reg3A Recombinant Protein Antigen (NBP2-56947PEP)

Learn more about PTMs related to Reg3A Recombinant Protein Antigen (NBP2-56947PEP).

Blogs on Reg3A

There are no specific blogs for Reg3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Reg3A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol REG3A