RCAN3 Antibody - BSA Free

Western Blot: RCAN3 Antibody [NBP1-58949] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Western Blot: RCAN3 Antibody [NBP1-58949] - Transfected HEK293.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RCAN3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RCAN3(RCAN family member 3) The peptide sequence was selected from the middle region of RCAN3. Peptide sequence PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCAN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RCAN3 Antibody - BSA Free

• Down syndrome candidate region 1-like 2
• Down syndrome critical region gene 1-like 2
• DSCR1L2regulator of calcineurin 3 isoform 13,45,MCIP3regulator of calcineurin 3 isoform 1a2,34,5
• hRCN3
• Myocyte-enriched calcineurin-interacting protein 3
• RCAN family member 3
• RCN3
• regulator of calcineurin 3 isoform 1a3,45,Down syndrome candidate region 1-like protein 2
• regulator of calcineurin 3 isoform 1b2,34,5
• regulator of calcineurin 3 isoform 1c2,34,5
• regulator of calcineurin 3 isoform 1c3,45,calcipressin-3
• Regulator of calcineurin 3

Background

RCAN3 inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. It could play a role during central nervous system development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RCAN3