RCAN2 Antibody - BSA Free

Western Blot: RCAN2 Antibody [NBP1-79477] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RCAN2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human RCAN2The immunogen for this antibody is RCAN2. Peptide sequence LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RCAN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RCAN2 Antibody - BSA Free

• Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2)
• calcipressin-2
• Down syndrome candidate region 1-like 1
• Down syndrome critical region gene 1-like 1
• DSCR1L1MCIP2ZAKI4RCN2
• hRCN2
• Myocyte-enriched calcineurin-interacting protein 2
• regulator of calcineurin 2CSP2
• thyroid hormone-responsive (skin fibroblasts)
• Thyroid hormone-responsive protein ZAKI-4
• ZAKI-4

Background

Calcipressin-2, also known as RCAN2, plays a key role in many physiological procedures. Expressed in fibroblasts, heart, brain, liver, and skeletal muscle, RCAN2 prevents calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Translocation of the transcription factor NFATC1 can also be attributed to the binding of calcineurin A. Further research indicates that RCAN could also play a role in endothelial cell function, angiogenesis and central nervous system development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RCAN2
• Uniprot:
  • NP_005813(Human)