RCAN2 Antibody


Western Blot: RCAN2 Antibody [NBP1-79477] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

RCAN2 Antibody Summary

Synthetic peptide directed towards the middle region of human RCAN2The immunogen for this antibody is RCAN2. Peptide sequence LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RCAN2 and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RCAN2 Antibody

  • Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2)
  • calcipressin-2
  • Down syndrome candidate region 1-like 1
  • Down syndrome critical region gene 1-like 1
  • hRCN2
  • Myocyte-enriched calcineurin-interacting protein 2
  • regulator of calcineurin 2CSP2
  • thyroid hormone-responsive (skin fibroblasts)
  • Thyroid hormone-responsive protein ZAKI-4
  • ZAKI-4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB

Publications for RCAN2 Antibody (NBP1-79477) (0)

There are no publications for RCAN2 Antibody (NBP1-79477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCAN2 Antibody (NBP1-79477) (0)

There are no reviews for RCAN2 Antibody (NBP1-79477). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RCAN2 Antibody (NBP1-79477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RCAN2 Antibody (NBP1-79477)

Discover related pathways, diseases and genes to RCAN2 Antibody (NBP1-79477). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCAN2 Antibody (NBP1-79477)

Discover more about diseases related to RCAN2 Antibody (NBP1-79477).

Pathways for RCAN2 Antibody (NBP1-79477)

View related products by pathway.

PTMs for RCAN2 Antibody (NBP1-79477)

Learn more about PTMs related to RCAN2 Antibody (NBP1-79477).

Research Areas for RCAN2 Antibody (NBP1-79477)

Find related products by research area.

Blogs on RCAN2

There are no specific blogs for RCAN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RCAN2 Antibody and receive a gift card or discount.


Gene Symbol RCAN2