RBMS3 Antibody


Western Blot: RBMS3 Antibody [NBP1-89497] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: RBMS3 Antibody [NBP1-89497] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: RBMS3 Antibody [NBP1-89497] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Western Blot: RBMS3 Antibody [NBP1-89497] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

RBMS3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQI
Specificity of human, mouse RBMS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBMS3 Protein (NBP1-89497PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RBMS3 Antibody

  • RNA binding motif, single stranded interacting protein 3
  • RNA-binding protein
  • single stranded interacting protein
  • single-stranded-interacting protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RBMS3 Antibody (NBP1-89497) (0)

There are no publications for RBMS3 Antibody (NBP1-89497).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBMS3 Antibody (NBP1-89497) (0)

There are no reviews for RBMS3 Antibody (NBP1-89497). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBMS3 Antibody (NBP1-89497) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RBMS3 Products

Bioinformatics Tool for RBMS3 Antibody (NBP1-89497)

Discover related pathways, diseases and genes to RBMS3 Antibody (NBP1-89497). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBMS3 Antibody (NBP1-89497)

Discover more about diseases related to RBMS3 Antibody (NBP1-89497).

Pathways for RBMS3 Antibody (NBP1-89497)

View related products by pathway.

PTMs for RBMS3 Antibody (NBP1-89497)

Learn more about PTMs related to RBMS3 Antibody (NBP1-89497).

Blogs on RBMS3

There are no specific blogs for RBMS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RBMS3 Antibody and receive a gift card or discount.


Gene Symbol RBMS3