RBMS3 Antibody - BSA Free

Western Blot: RBMS3 Antibody [NBP1-89497] - Analysis in human cell line U-2 OS and human cell line HEK 293.

Immunocytochemistry/Immunofluorescence: RBMS3 Antibody [NBP1-89497] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: RBMS3 Antibody [NBP1-89497] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBMS3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBMS3 Antibody - BSA Free (NBP1-89497) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RBMS3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQI
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBMS3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBMS3 Protein (NBP1-89497PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RBMS3 Antibody - BSA Free

• RNA binding motif, single stranded interacting protein 3
• RNA-binding protein
• single stranded interacting protein
• single-stranded-interacting protein 3

Background

The protein encoded by the RBMS3 gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBMS3 Antibody (NBP1-89497)(2)

Publications using NBP1-89497

• Wang L, Nykänen N, Western D et al. Proteo-genomics of soluble TREM2 in cerebrospinal fluid provides novel insights and identifies novel modulators for Alzheimer’s disease medRxiv 2023-06-21 (WB, Human)
• Wang, L;Nykänen, NP;Western, D;Gorijala, P;Timsina, J;Li, F;Wang, Z;Ali, M;Yang, C;Liu, M;Brock, W;Marquié, M;Boada, M;Alvarez, I;Aguilar, M;Pastor, P;Ruiz, A;Puerta, R;Orellana, A;Rutledge, J;Oh, H;Greicius, MD;Le Guen, Y;Perrin, RJ;Wyss-Coray, T;Jefferson, A;Hohman, TJ;Graff-Radford, N;Mori, H;Goate, A;Levin, J;Sung, YJ;Cruchaga, C; Proteo-genomics of soluble TREM2 in cerebrospinal fluid provides novel insights and identifies novel modulators for Alzheimer's disease Molecular neurodegeneration 2024-01-03 [PMID: 38172904]

Bioinformatics

• Gene Symbol: RBMS3