Orthogonal Strategies: Western Blot: RBMS3 Antibody [NBP1-89497] - Analysis in human cell line U-2 OS and human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: RBMS3 Antibody [NBP1-89497] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: RBMS3 Antibody [NBP1-89497] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: MNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQI
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBMS3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for RBMS3 Antibody - BSA Free
RNA binding motif, single stranded interacting protein 3
RNA-binding protein
single stranded interacting protein
single-stranded-interacting protein 3
Background
The protein encoded by the RBMS3 gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
We have publications tested in 1 confirmed species: Human.
We have publications tested in 1 application: WB.
Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-89497
Applications
Species
Wang L, Nykänen N, Western D et al. Proteo-genomics of soluble TREM2 in cerebrospinal fluid provides novel insights and identifies novel modulators for Alzheimers disease medRxiv 2023-06-21 (WB, Human)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our RBMS3 Antibody - BSA Free and receive a gift card or discount.